KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111673433
Entry
111673433         CDS       T06058                                 

Definition
(RefSeq) lysophosphatidic acid receptor 2-like
  KO
K04291  lysophosphatidic acid receptor 2
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04080  Neuroactive ligand-receptor interaction
slal04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111673433
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111673433
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:slal04030]
    111673433
G protein-coupled receptors [BR:slal04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    111673433
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srv Claudin_2 Ninjurin
Other DBs
NCBI-GeneID: 111673433
NCBI-ProteinID: XP_023286961
LinkDB
Position
Unknown
AA seq 371 aa
MDTVTEDKEGCYFNRSVKFFYEESGKNISDHWRKRDYVIVTLGMTVCFIVIFSNLLVIGA
ILKNRRFHFPIYYLLGNLALADLFSGISYLHLMFHTGPWTIKLSKHQWFVRQGLIDTSLT
ASVLNLLAVAVERHQTIFNMQLHSKMSTRRVFIIMLFIWLVAIVMGLVPTMGWHCLCDLP
NCSTMAPMYSRSYLVFWALLNLLTFSIMVAVYTRIFVYVRHKSKQMSQHTSQMRYKETVL
NLMKTVSMILGCFVVCWTPGLVVLLLDGLGCERCKVLRYEKYCLVLAECNSFVNPIIYSF
RDKDMRRTFKDILCCLFQRSSNHQGNSGAHFNTLEHENYKSRTAEPVEKSNGTPLIHEGS
EDLPASSENWN
NT seq 1116 nt   +upstreamnt  +downstreamnt
atggatacggtgaccgaggacaaagagggatgctacttcaaccgttctgtcaaatttttc
tatgaggagagcggcaagaacatcagcgaccactggcgcaaacgtgactatgtgatcgtc
acgctgggcatgacggtctgcttcattgtcatcttttccaaccttttggtcataggggcc
attttaaaaaaccgacgctttcactttcctatctactacctgttgggtaacctggcgttg
gcagacctcttctcaggtatctcctacctccacttgatgtttcacaccggtccttggacc
attaagctgtccaagcaccagtggtttgtgcgacaggggctgatcgacaccagtctgaca
gcctccgtcctcaacctcctggccgtggcggtggaacgccaccagaccatcttcaacatg
cagctgcacagcaagatgagcacccggcgggtgttcatcatcatgctgttcatctggctg
gtggcgatagtcatgggcctggttcccaccatgggctggcactgtctctgtgacctgccg
aactgctccaccatggccccgatgtacagccgcagctacttggtgttctgggcccttctc
aatctgctgaccttctccatcatggtggccgtctacacccggatatttgtctacgtgagg
cacaagagcaagcagatgtcgcagcacacctcccagatgagatacaaggagacggtgctc
aacctgatgaagaccgtctccatgatcctgggctgttttgtggtctgctggacgcccggc
ctggtcgtgctgctgctcgacggtctgggctgtgaaaggtgtaaggtgctacgctacgag
aagtactgcctggtgcttgccgagtgcaactccttcgtcaaccccatcatctactccttc
agggacaaagacatgagaaggaccttcaaggacatcctgtgctgcctgttccagcgcagc
agcaaccaccagggcaactctggagctcactttaacaccctggagcacgagaactataag
tctcgtactgctgagccagtagagaagagcaacgggacgcctctcatccacgaaggctca
gaagacttacctgcctcttcagaaaactggaattaa

DBGET integrated database retrieval system