KEGG   Streptomyces laurentii: SLA_0209Help
Entry
SLA_0209          CDS       T05205                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
slau  Streptomyces laurentii
Pathway
slau00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:slau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SLA_0209
Enzymes [BR:slau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     SLA_0209
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     SLA_0209
    1.1.1.-  
     SLA_0209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: BAU81164
UniProt: A0A160NTP0
LinkDB All DBs
Position
222223..223287
Genome map
AA seq 354 aa AA seqDB search
MKAARYYDRGDIRIEDIPEPTVRPGTVGIDVAFCGICGTDLHEYLDGPIFVPPAGHPHPV
SGEAAPVTLGHEMSGVVYAVGEGVEDLKPGDRVVVEPYILRPDVDTSENNPTYHLSPDMN
FIGLGGRGGGLAEKIVVERRWVHPVGDVPLDQAALIEPLSVGYHAFDRSGAKAGDFALVG
GAGPIGLLTCAVLKAMGVEVAVSELSPLRRQKALDAKVADHVIDPATTDVTSEVQRLTGG
KGADVAFEATSVNVVLDTLFDAVKPGGVITVISIWGKPATIDMQKLVLKEVDLRGTIAYV
NSHPQTIKLVQEGRIDLSPFITKTIGLDGLVDEGFETLIHHNETAVKILVDPRR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgcacgctactacgaccgcggcgacatccgtatcgaggacatccccgagccc
accgtccgcccgggcaccgtcggcatcgatgtcgcgttctgcggcatctgcggtaccgac
ctgcacgaatacctcgacggaccgatcttcgtcccaccggccggccacccgcaccccgtc
tccggcgaggccgcccccgtcacgctcggccacgagatgtccggcgtggtgtacgcggtg
ggcgagggcgtcgaggacctgaagccgggcgaccgggtcgtcgtcgagccctacatcctg
cgccccgacgtcgacaccagcgagaacaacccgacctaccacctctcccccgacatgaac
ttcatcgggctcggaggccggggcggcggtctcgccgagaagatcgtcgtcgagcgccgg
tgggtgcacccggtcggtgacgtccccctggaccaggcggccctcatcgagccgctgtcc
gtgggctaccacgccttcgaccgctcgggcgcgaaggcgggcgacttcgccctggtcggc
ggtgcgggccccatcgggctgctgacctgcgcggtgctcaaggcgatgggcgtcgaggtc
gcggtcagcgagctcagcccgctgcgccgccagaaggccctggacgccaaggtcgccgac
catgtcatcgacccggccaccaccgatgtcacctccgaggtccagcgcctcacgggcggc
aagggcgcggacgtcgcgttcgaggccacgtccgtgaacgtcgtcctcgacaccctgttc
gacgcggtcaagccgggcggtgtcatcaccgtcatctcgatctggggcaagccggcgacg
atcgacatgcagaagctcgtcctcaaggaggtcgacctgcgcggcaccatcgcctacgtg
aactcccacccgcagaccatcaaactggtccaggagggacggatcgacctgtcgccgttc
atcaccaagacgatcgggctggacggcctcgtggacgagggcttcgagaccctcatccac
cacaacgagacggccgtcaagatcctcgtggacccgcgccgctga

DBGET integrated database retrieval system