KEGG   Streptomyces laurentii: SLA_1943Help
Entry
SLA_1943          CDS       T05205                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
slau  Streptomyces laurentii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: BAU82881
UniProt: A0A160NY97
LinkDB All DBs
Position
complement(2051904..2053376)
Genome map
AA seq 490 aa AA seqDB search
MTGLVEHGELFIGGTWTAPLGDGVIEVISPHTEEVIGRVPHASPADVDRAVAAARRAFDE
GPWPRLGLEERIEVIGRIKDALLLRHEEIARVVSSQNGSPYSWSVLAQALGAMMVWDSAI
KVAREYAFEERRAGALGPLLVRREPVGVVAAVVPWNVPQFTAAAKLAPALLAGCTAILKP
SPESPLDAYLLAEIAAEAGLPEGVLSVLPADREVSEYLVGHPGVDKVSFTGSVAAGKRVM
EVAARHLTRVTLELGGKSAAVVLPDADVATAVAGIVPAAWMNNGQACVAQTRVLAPRSRY
AEIAEALAAAAGALVVGDPLDPATQVGPLVARRQRERSLDYIAHGQSEGAKVLTGGGRPA
ALERGWYVEPTLFGDVDNSMRIAREEIFGPVVCLIPYGDEAEALRLANDSDYGLSGSVWT
GDVEHGVDFARGVRTGTFNVNTFSLDMLGPFGGYKNSGLGREFGPEGLAAYLEHKMIHLP
AGYEAPGSGA
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaccggacttgtggagcacggagaactgttcatcggcggtacgtggaccgccccgctc
ggcgacggcgtcatcgaggtgatctccccgcacaccgaggaggtcatcggccgggtcccg
cacgcctccccggccgacgtcgaccgcgccgtcgccgccgcccgccgggccttcgacgag
gggccgtggccgcggctgggcctggaggagcggatcgaggtgatcggccggatcaaggac
gcactcctgctccggcacgaggagatcgcccgcgtcgtcagctcccagaacggctccccg
tactcctggtcggtcctcgcccaggcgctgggcgcgatgatggtctgggactcggcgatc
aaggtcgcgcgggagtacgcgttcgaggagcggcgcgccggtgccctcgggccgctgctc
gtccggcgggaaccggtcggtgtggtcgcggccgtcgtgccgtggaacgtgccgcagttc
accgccgccgccaagctcgcgcccgcgttgctcgccggctgcaccgcgatcctcaagccg
tcgccggagtcgccgctcgacgcgtatctgctcgcggagatcgccgccgaggccgggctg
ccggagggcgtcctgtcggttcttcccgccgaccgggaggtcagcgagtacctggtgggg
caccccggcgtcgacaaggtctccttcaccggctcggtcgccgccggcaagcgggtcatg
gaggtcgccgcccgccatctcacccgcgtcaccctcgaactgggcggcaagtccgccgcc
gtcgtcctgccggacgccgacgtggcgacggccgtcgccggcatcgtgcccgccgcctgg
atgaacaacggccaggcctgcgtcgcccagacccgcgtcctcgccccgcgctcccggtac
gcggagatcgccgaggccctcgcggccgcggccggggccctcgtggtcggcgacccgctc
gacccggccacccaggtcggcccgctcgtcgcgcgccgccagcgggagcggtccctcgac
tacatcgcgcacggtcagtccgaaggcgccaaggtcctcaccggcggcggccgtccggcg
gccctggaacgcggctggtacgtcgagccgaccctcttcggcgacgtcgacaactccatg
cggatcgcccgcgaggagatcttcggcccggtcgtctgcctcatcccgtacggcgacgag
gcggaggccctgcgcctcgcgaacgactccgactacggcctcagcggcagcgtgtggacc
ggcgacgtcgagcacggcgtcgacttcgcgcgcggggtccgcaccggcaccttcaacgtc
aacaccttcagcctcgacatgctcggccccttcggcgggtacaagaactccggcctgggc
cgcgagttcgggcccgagggactggccgcctacctggagcacaagatgatccacctgccc
gccggttacgaggctccggggagtggtgcctga

DBGET integrated database retrieval system