KEGG   Streptomyces laurentii: SLA_2710Help
Entry
SLA_2710          CDS       T05205                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
slau  Streptomyces laurentii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Kinase-like PhoR
Motif
Other DBs
NCBI-ProteinID: BAU83631
UniProt: A0A160NZY5
LinkDB All DBs
Position
complement(2821011..2822786)
Genome map
AA seq 591 aa AA seqDB search
MRPIGSKYLLEEPLGRGATGTVWRARQRETAGAEAAVPGEPGETVAIKVLKEELANDADI
VMRFLRERSVLLRLTHANIVRTRDLVVEGDVLALVMDLVDGPDLHRYIRESGPLTPVAAA
LLTAQIADALAASHADGVVHRDLKPANVLLRQDGDALHPMLTDFGIARLADSPGLTRTHE
FVGTPAYVAPESAEGRPQTSAVDIYGAGILLYELVTGRPPFGGGTALEVLHQHLTEEPRR
PSTVPAPLWTVIERCLRKNPDERPSAENLARGLRAVAAGIGVHATPDQIEAAEGVGALLA
PDPAPAPVPGSPAAADPAGATQVLPTGSAAPAGIGQQGAYDPAAPTSVLPAGGPAGAADP
TAVLPAGGPGADPTRAMPPVPQDPPGEQPHPWQSQLRAARDRNEPTQMQYLDPSEDPLRR
RPQRRPQQPPHPPQQYQQPQPQQYQQPQQYRQQPPQAPPPAPYQQQPHPPQQYAPQPPPQ
QQYAPPQPPPPPAPAPAPAPARAPREPRPPRQRSANPMRIPGLGCLKGCLFTIVLFVVAG
WLVWELTPLQDWIAQGKGYWEAIGDGISSLTDWISSLTESTGTGGGGTAGQ
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
gtgcggcctatcggcagcaagtacctgctcgaggagccgctcggccgcggcgccacgggc
accgtctggcgagcccgccagcgggagacggccggcgccgaggcggcggtgccgggcgag
cccggcgagaccgtcgcgatcaaggtcctcaaggaggagctcgccaacgacgcggacatc
gtgatgcgcttcctgcgcgagcgctccgtgctgctgcggctcacccacgccaacatcgtg
cgcacccgcgacctggtcgtggagggcgacgtcctcgccttggtcatggacctcgtcgac
ggccccgacctgcaccgttacatccgtgagagcggcccgctcaccccggtcgccgccgcg
ctgctcaccgcgcagatcgccgacgcgctggccgccagccacgccgacggcgtcgtccac
cgcgacctcaaacccgcgaacgtgctgctccggcaggacggcgacgccctgcacccgatg
ctcaccgacttcggcatcgcgcgcctcgccgactccccgggcctgacccgcacccacgaa
ttcgtcggtacgcccgcgtacgtggcgccggagtccgccgagggccgcccgcagacctcc
gccgtcgacatctacggcgccggcatcctgctgtacgaactggtcaccggacggcccccg
ttcggcggcggcaccgccctggaggtgctgcaccagcacctcaccgaggagccgcgccgc
ccgtccaccgtgcccgccccgctgtggacggtcatagagcgctgcctgcgcaagaacccg
gacgagcggcccagcgccgagaacctcgcccgcggcctgcgcgccgtcgccgccggcatc
ggcgtgcacgccacccccgaccagatcgaggccgccgagggcgtcggcgcgctgctcgcg
cccgacccggcccccgcgccggtcccgggcagccccgccgcggccgatccggccggcgcc
acccaggtgctgcccaccggttccgccgccccggcgggcatcggtcagcagggcgcgtac
gacccggccgcgcccaccagcgtgctgcccgcaggcggtccggccggtgcggccgacccg
accgccgtgctccccgcgggcggccccggcgccgatccgacccgggccatgccgcccgta
ccgcaggatccgccgggcgagcagccacacccctggcagagccagctgcgcgcggcccgc
gaccgcaacgagccgacgcagatgcagtacctcgacccgagcgaggacccgttgcgccgg
cgcccgcagcgccgcccccagcagcccccgcacccgccgcagcagtaccagcagccgcag
ccgcagcagtaccagcagccgcagcagtaccggcagcagcctccgcaggccccgccgccg
gcgccgtaccagcagcagccgcatccgccgcagcagtacgccccccagccgccgccgcag
cagcagtacgcgccgccgcagcctccgccgcccccggcgcccgcacccgcccccgcgccc
gcccgcgcgccgcgcgagccccgtccgccgcggcagcgcagcgccaacccgatgcgcatc
ccgggcctcggctgcctgaagggctgcctcttcacgatcgtgctgttcgtggtcgcgggc
tggctcgtctgggagctgaccccgctccaggactggatcgcccagggcaagggctactgg
gaggcgatcggcgacggcatctcctcgctgaccgactggatctcgtcgctcaccgagagc
acggggacgggcggcggcggtaccgccgggcagtga

DBGET integrated database retrieval system