KEGG   Streptomyces laurentii: SLA_2902Help
Entry
SLA_2902          CDS       T05205                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
slau  Streptomyces laurentii
Pathway
slau00620  Pyruvate metabolism
slau00680  Methane metabolism
slau01100  Metabolic pathways
slau01120  Microbial metabolism in diverse environments
slau01200  Carbon metabolism
Module
slau_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:slau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SLA_2902
  09102 Energy metabolism
   00680 Methane metabolism
    SLA_2902
Enzymes [BR:slau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SLA_2902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: BAU83818
UniProt: A0A169NHD4
LinkDB All DBs
Position
complement(3031887..3034616)
Genome map
AA seq 909 aa AA seqDB search
MSSADQTSTASSELRSDIRRLGDLLGETLVRQEGHALLELVEKVRRLTREDGDAAAELLR
GVELETAAQLVRAFSTYFHLANVTEQVHRGRELRDKRAAEGGLLARTADMLKDGDADHVR
ATIRNLNVRPVFTAHPTEAARRSVLNKLRRIAALLDTPVIEADRRRHDLRLAENIDLIWQ
TDELRVVRPEPSDEARNAIYYLDELHADAVGDVLEDLAAELERVGFELPAGTRPLTFGTW
IGGDRDGNPNVTPQVTWDVLILQHEHGITDALELVDFLRGLLSNSIRYAGATEELLESLQ
ADLERLPEISPRYKRLNAEEPYRLKVTCVRQKLLNTRDRLAKGTPHQEGRDYLGTDELLR
DLTLVQTSLREHRGGLFADGRMDRTIRTLAAFGLQLATMDVREHADAHHHALGQLFDRLG
EESWRYADMPREYRQKLLAKELRSRRPLAPTPAPLDAAGQKTLGVFQTVGRALGVFGPDV
IESYIISMCQGADDVFAATVLAREAGLIDLHAGWAKIGIVPLLETTDELRAADVILDDML
ADPSYRRLVSLRGDVQEVMLGYSDSSKFGGITTSQWEIHRAQRRLRDVAHRYGVRLRLFH
GRGGTVGRGGGPSHDAILAQPWGTLEGEIKVTEQGEVISDKYLIPSLARENLELTVAATL
QASALHTAPRQSDEALARWDAAMDTVSDAAHGAYRRLVEDPDLPAYFFASTPVDQLADLH
LGSRPSRRPDSGAGLDGLRAIPWVFGWTQSRQIVPGWYGVGSGLKALREAGLDAVLGEMY
DRWHFFRNFVSNVEMTLAKTDLRIARHYVDTLVPDDLRHVFETIEAEHALTVAEVLKVTG
GQRLLDSNPVLQQTFAIRDAYLDPISYLQVALLDRQRSAAEAGTEPDPLLARALLLTVNG
VAAGLRNTG
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtgccgaccagacctccaccgccagctccgagctgcgctccgacatccgccga
ctgggcgacctgctgggcgagacgctcgtccgccaggagggtcacgccctcctggaactc
gtcgagaaggtccgccgcctcacccgcgaggacggcgacgccgccgccgagctgctgcgc
ggagtcgaactcgagaccgccgcccagctggtgcgcgcgttctccacgtacttccatctc
gccaacgtcaccgaacaggtgcaccgcggccgcgagctgcgcgacaagcgcgccgccgag
ggcggactgctcgcccggacggcggacatgctcaaggacggcgacgccgaccacgtccgc
gccaccatccgcaacctcaacgtgcggccggtcttcaccgcccacccgaccgaggccgcc
cggcgctccgtcctcaacaagctgcgccgcatcgccgccctcctcgacacccccgtcatc
gaggccgaccggcgccgccacgacctgcggctcgccgagaacatcgacctcatctggcag
accgacgaactgcgcgtcgtccgccccgagccctccgacgaggcccgcaacgccatctac
tacctcgacgaactgcacgccgacgccgtcggcgacgtccttgaggacctggccgccgaa
ctggaacgcgtcggcttcgagctgcccgccggcacccgcccgctcaccttcggcacctgg
atcggcggcgaccgcgacggcaaccccaacgtcaccccccaggtcacctgggacgtgctg
atcctccagcacgagcacggcatcaccgacgccctcgaactcgtcgacttcctgcgcggg
ctgctctccaactccatccggtacgccggcgccaccgaggaactcctcgaatccctccag
gccgacctcgaacgactgcccgagatcagcccccgctacaagcgcctcaacgccgaggag
ccctaccggctcaaggtcacctgcgtccgccagaagctcctcaacacccgcgaccgcctc
gccaagggcaccccccaccaggagggccgcgactacctcggcaccgacgagctgctccgc
gacctcaccctcgtccagacctccctgcgcgagcaccgcggcggcctgttcgccgacggc
cggatggaccgcaccatccgcacgctcgccgccttcggcctccagctcgccaccatggac
gtccgcgagcacgccgacgcccaccaccacgccctcggccagctgttcgaccggctgggc
gaggagtcctggcgctacgccgacatgccccgcgagtaccggcagaagctcctcgccaag
gaactgcgctcccgccgcccgctcgcccccaccccggcgcccctcgacgccgccggccag
aagaccctcggcgtcttccagaccgtcggccgcgccctcggcgtcttcggccccgacgtc
atcgagtcgtacatcatctccatgtgccagggcgccgacgacgtcttcgccgccaccgtc
ctcgcccgcgaggccggcctgatcgacctgcacgccggctgggcgaagatcggcatcgtc
cccctcctggagaccaccgacgagctcagggccgccgacgtcatcctcgacgacatgctc
gccgacccctcgtaccgccgcctcgtctccctgcgcggcgacgtccaggaggtcatgctc
ggctactccgactcctcgaagttcggcggcatcaccacctcccagtgggagatccaccgc
gcccagcgccggctgcgcgacgtcgcccaccgctacggcgtacggctccgcctcttccac
ggccgcggcggcaccgtcggccgcggcggcggcccctcccacgacgccatcctcgcccag
ccctggggcaccctggagggcgagatcaaggtgaccgagcagggcgaggtcatctccgac
aagtacctcatcccgtcgctcgcccgcgagaacctcgaactgaccgtcgcggccaccctg
caggcctccgccctgcacaccgcgccccgccagtccgacgaggccctcgcccgctgggac
gccgccatggacaccgtgtccgacgcggcccacggcgcgtaccggcggctggtcgaggac
cccgacctgcccgcgtacttcttcgcctccacccccgtcgaccagctcgccgacctccac
ctcggctcccggccgtcccgccgccccgactccggcgccggcctcgacggactgcgcgcc
atcccctgggtgttcggctggacccagtcccggcagatcgtccccggctggtacggcgtc
gggtcgggcctcaaggccctgcgcgaggccggcctcgacgccgtcctcggcgagatgtac
gaccgctggcacttcttccgcaacttcgtctccaacgtcgagatgacgctggccaagacc
gacctgcggatcgcccgccactacgtcgacaccctcgtccccgacgacctgcggcacgtc
ttcgagaccatcgaggccgaacacgccctcaccgtcgccgaggtgctcaaggtgaccggc
gggcagcggctgctcgactccaaccccgtcctgcagcagaccttcgccatccgcgacgcc
tacctcgacccgatctcgtacctccaggtcgccctgctcgaccgtcagcggtccgccgcc
gaggccgggaccgagcccgacccgctgctcgcccgggcgctgctgctcaccgtgaacggt
gtggcggcgggcctgcgcaacaccggctga

DBGET integrated database retrieval system