KEGG   Streptomyces laurentii: SLA_3339Help
Entry
SLA_3339          CDS       T05205                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
slau  Streptomyces laurentii
Pathway
slau00250  Alanine, aspartate and glutamate metabolism
slau00410  beta-Alanine metabolism
slau00430  Taurine and hypotaurine metabolism
slau00650  Butanoate metabolism
slau01100  Metabolic pathways
slau01110  Biosynthesis of secondary metabolites
slau01120  Microbial metabolism in diverse environments
slau02024  Quorum sensing
Module
slau_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:slau00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    SLA_3339
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SLA_3339
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SLA_3339
   00430 Taurine and hypotaurine metabolism
    SLA_3339
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    SLA_3339
Enzymes [BR:slau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SLA_3339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: BAU84250
UniProt: A0A160P1M2
LinkDB All DBs
Position
3502356..3503774
Genome map
AA seq 472 aa AA seqDB search
MALHKGPQEEPEAELFRRLSLNPFYGEANPVGGMTEAPPRHRLPDGPLPPMSAYQLVRDE
LMLDGNSRLNLATFVTTWMEPQAGVLMNDCRDKNMIDKDEYPRTAELERRCVAMLAQLWN
APDPSAAVGCSTTGSSEACMLAGMALKRRWTKRNADRYPGARPNLVMGVNVQVCWEKFCN
FWEVEPRLVPMEGDRFHLDAESAAALCDENTIGVVAVLGSTFDGSYEPVADICAALDALQ
ERTGLDIPVHVDGASGAMIAPFVDEDLEWDFRQPRVSSINTSGHKYGLVYPGVGWALWRT
PDELPEELVFRVNYLGGEMPTFALNFSRPGAQVVAQYYTFLRLGRSGYQAVQQTARDIAR
GLAERIDALGDFRLLTRGDQLPVFAFTTGPDVTAYDVFDVSRRLRESGWLVPAYTFPANR
QDLSVLRVVCRNGFSADLAELFLEDLRRLLPELRRQPRPFTHDKAAATSFHH
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
gtggcgctgcacaagggcccccaggaggagccggaggccgagctgttccgccggctctcc
ctcaacccgttctacggcgaggccaatcccgtcggcggcatgaccgaggccccgccccgc
caccggctgcccgacgggccgctgccgccgatgagcgcctaccagctggtccgcgacgag
ctgatgctcgacggcaattcacgcctcaacctggccaccttcgtcaccacctggatggag
ccgcaggccggggtgctgatgaacgactgccgcgacaagaacatgatcgacaaggacgag
tacccgcgcaccgccgaactggagcgccgctgcgtcgccatgctcgcccagctgtggaac
gcacccgacccgtcggccgccgtcggctgctccaccaccggttcgtccgaggcgtgcatg
ctcgccggcatggcgctcaagcggcgctggacgaagcgcaacgccgaccgctaccccggc
gcccgccccaacctggtcatgggcgtcaacgtgcaggtctgctgggagaagttctgcaat
ttctgggaggtcgagccccggctcgtccccatggagggcgaccgcttccacctcgacgcc
gagtccgccgccgcgctctgcgacgagaacaccatcggtgtcgtcgccgtcctcggctcc
accttcgacggttcctacgagcccgtcgccgacatctgcgccgcgctcgacgccctccag
gaacggaccggcctcgacatccccgtgcacgtcgacggcgcgtccggcgccatgatcgcg
ccgttcgtcgacgaggacctggagtgggacttccggcagccccgggtgtcgtcgatcaac
acctccgggcacaagtacgggctcgtctacccgggggtcggctgggcgttgtggcgcacg
cccgacgagctgcccgaggagctggtgttccgggtcaactacctgggcggcgaaatgccg
accttcgcgctcaacttctcccggcccggcgcgcaggtcgtcgcgcagtactacacgttc
ctgcggctgggccgcagcggctaccaggcggtccagcagaccgcccgcgacatcgcccgc
ggactcgccgaacggatcgacgccctgggcgacttccggctcctcacccggggcgaccag
ctgccggtgttcgccttcaccaccggcccggacgtcaccgcgtacgacgtcttcgacgtg
tcgcggcggctgcgcgagagcggctggctggtccccgcgtacaccttccccgcgaaccgg
caggacctgtccgtgctgcgcgtggtctgccgcaacggcttctccgccgacctggccgag
ctgttcctggaggacctgcgacggctgctgcccgaactgcggcgccagccccgcccgttc
acccacgacaaggcggccgcgacctccttccaccactga

DBGET integrated database retrieval system