KEGG   Streptomyces laurentii: SLA_5153Help
Entry
SLA_5153          CDS       T05205                                 

Definition
(GenBank) DNA ligase
Organism
slau  Streptomyces laurentii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: BAU86035
UniProt: A0A160P527
LinkDB All DBs
Position
complement(5326761..5327822)
Genome map
AA seq 353 aa AA seqDB search
MTAADPGRASGAGDPGRAGGAGGAGGASGIVLRPPLEVMRPRSVDEIPRQGGVPGGFQYS
LKLDGFRALAFVLDGGRVVLQSRARRDLAPEFPGIAGYLGERLPPGVVLDGELCAYREGR
LSFTDLLRTHRDRERAGVPVSYIAFDLLALPGRDLRGRPLRERWDLLAEALAGTGPPLQR
VLATDDEATAREWFGALRAAGVEGIVAKAWDSTYRPGPTWSWRKIRHADTEDALLVGVFG
PPDRPHALLVRLADGRTLRTSPRLTGPQAHQVAELTAGAGLLGAPEEDPEHGTVRPLAAP
LPVELRLPAGRQDRPDTARFVRVRDATAPDASAAPTALPGERPPGEHPPADGR
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgccgccgacccgggccgggcaagcggggcaggcgacccgggccgggcaggcggg
gcaggcggggcaggcggggcaagcggcatcgtgctgcgcccgccgctggaggtcatgcgg
ccgcgttccgtggacgagatcccccggcagggcggggtcccgggcggcttccagtactcc
ctcaagctcgacggtttccgcgccctcgccttcgtcctcgacggcggccgggtcgtcctg
cagtcccgggcccggcgcgacctggcgccggagttccccgggatcgccggctacctgggc
gaacggctgccgccgggcgtcgtcctggacggcgagctgtgcgcgtaccgcgagggccgg
ctcagcttcaccgacctgctgcgcacgcaccgggaccgcgagcgggccggcgtccccgtc
tcgtacatcgccttcgatctgctcgccctgcccgggcgcgatctgcgcggccggccgctg
cgggaacgctgggacctgctcgccgaggcgctcgccggcaccggcccgccgctccagcgg
gtgctcgcgaccgacgacgaggcgacggcccgcgagtggttcggcgcgctgcgcgcggcg
ggcgtggaggggatcgtggcgaaggcgtgggactccacgtaccgtccgggccccacctgg
tcgtggcggaagatccggcacgcggacaccgaggacgccctgctggtcggggtgttcggg
ccgccggaccggccgcacgcgctgctcgtccggctcgccgacggccgcaccctgcgcacc
agcccgcgcctcaccggcccccaggcgcaccaggtcgccgagctgacggcgggcgcgggg
ctgctcggcgcgccggaggaggacccggagcacgggaccgtacggccgctcgccgcaccc
ctgccggtcgagctgcgcctgcccgcggggcgccaggaccggccggacacggcgcgcttc
gtccgcgtacgcgacgcgaccgcgcccgacgcgtcggccgcgccgaccgcgctgcctggt
gagcgcccgccgggtgagcacccgcccgcagacggccggtga

DBGET integrated database retrieval system