KEGG   Streptomyces laurentii: SLA_5154Help
Entry
SLA_5154          CDS       T05205                                 

Definition
(GenBank) ATP-dependent DNA ligase clustered with ku protein, ligD
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
slau  Streptomyces laurentii
Pathway
slau03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:slau00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    SLA_5154
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:slau03400]
    SLA_5154
Enzymes [BR:slau01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SLA_5154
DNA repair and recombination proteins [BR:slau03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     SLA_5154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: BAU86036
UniProt: A0A160P4X2
LinkDB All DBs
Position
complement(5327819..5328712)
Genome map
AA seq 297 aa AA seqDB search
MTPVTEVAGRRLSLSNLDKVIHPATGTTKGELLHYYATVGAAILPHLRDRPVSFLRYPDG
PDGQLFFTKNPPPGTPAWVTTTPVPRSDAPRARQVMIQDLPSLVWAANLVVEFHTPQWRA
GSPAVADRLVLDLDPGPPATVVECCRVALHLRERLAADGITAYPKTSGSKGLHLLAPLAP
TPSAEVSAYARRLAVEAAAELPALVVHRMTKALRPGKVFVDFSQNAAAKTTATPYTLRAR
RLPAVSAPVTWEEVADTAAGGDPGRLVLLLDAVPPRLERYGDLLAPLFDTSAAGALP
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacgccggtcacggaggtggcggggcggcgcctttccctgagcaacctggacaaggtc
atccacccggccaccggcaccaccaaaggggagctgctccactactacgccaccgtcggg
gccgcgatcctgccgcatctgcgcgaccgcccggtgtccttcctgcgctatcccgacggc
cccgacggccagctcttcttcaccaagaatccgccgcccggcacccccgcctgggtgacg
accaccccggtgccccgctcggacgcgccccgcgcccgccaggtgatgatccaggacctg
ccgtcgctggtgtgggcggcgaatctggtggtggagttccacaccccgcagtggcgggcc
ggctcccccgccgtcgccgaccggctggtcctcgacctcgacccggggccgcccgcgacc
gtcgtcgagtgctgccgggtcgcgctccacctgcgggaacggctcgcggccgacgggatc
acggcgtacccgaagacctccggctccaagggcctgcacctgctcgcgccgctggccccg
accccgtccgccgaggtgtccgcgtacgcgcgccggctcgccgtcgaggcggcggcggag
ctgcccgcgctggtcgtgcaccggatgaccaaggccctgcgccccggcaaggtcttcgtc
gacttcagccagaacgccgccgcgaagaccaccgcgaccccctacaccctgcgggcccgc
cggctgcccgccgtgtccgcgcccgtgacctgggaggaggtcgcggacacggcggccggt
ggtgacccggggcggctggtgctgctgctggacgccgtaccgccgcggctggagcggtac
ggggatctgctcgccccgctcttcgatacgtcggcggccggagccctgccgtga

DBGET integrated database retrieval system