KEGG   Streptomyces laurentii: SLA_6220Help
Entry
SLA_6220          CDS       T05205                                 

Definition
(GenBank) aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
slau  Streptomyces laurentii
Pathway
slau00250  Alanine, aspartate and glutamate metabolism
slau00410  beta-Alanine metabolism
slau00640  Propanoate metabolism
slau00650  Butanoate metabolism
slau01100  Metabolic pathways
slau01120  Microbial metabolism in diverse environments
Module
slau_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:slau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SLA_6220
   00650 Butanoate metabolism
    SLA_6220
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SLA_6220
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SLA_6220
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:slau01007]
    SLA_6220
Enzymes [BR:slau01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SLA_6220
Amino acid related enzymes [BR:slau01007]
 Aminotransferase (transaminase)
  Class III
   SLA_6220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: BAU87089
UniProt: A0A160P5Q3
LinkDB All DBs
Position
6545156..6546436
Genome map
AA seq 426 aa AA seqDB search
MSNLYDRHRAVLPEWLALYYREPLEITHGEGRHVWDADGNRYLDFFGGILTTMTAHALPE
VTKAVAEQAGRIIHSSTLYLNRPMVELAERIATLSGIPDARVFFTTSGTEANDTALLLAT
AYRGSSQILAMRNSYHGRSFSTVGITGNRSWSPTGLSPLHTLYVHGGVRTRGPYAQYSDE
RFIEACVADLEDLLGHTRDVAALIAEPIQGVGGFTAPPDGLYAAFRQVLDRHGILWISDE
VQTGWGRTGEHFWGWQAHGQAGPPDILTFAKGIGNGMSIGGVVAREEVMNSLDANSISTF
GGSPVTMAAGLANLGYLLDHDLQGNARRVGGLLIERIRAAAAGVDAVREVRGRGLMIGVE
LTRPGTDLAHPEAAAAVLETARENGLLLGKGGGHNTSTLRIAPPLSLTVAEAEEGASILE
QALHAL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaatctgtacgaccggcaccgcgccgtcctccccgagtggctcgccctctactac
cgcgagcccctggagatcacccacggagaaggccgtcatgtctgggacgccgacggcaac
cgctacctcgacttcttcggcggcatcctcaccactatgaccgcccacgcgctccccgag
gtcaccaaggccgtcgccgagcaggccgggcggatcatccactcctccaccctctacctc
aaccggcccatggtggagctggccgaacggatcgccaccctctccggcatccccgacgcc
cgcgtcttcttcaccacctccggcaccgaggccaacgacaccgcgctgctcctggccacc
gcgtaccgcggctccagtcagatcctggccatgcgcaacagctaccacggccgctccttc
tccaccgtcggcatcaccggcaaccgctcctggtcgcccaccggcctctcgccgctgcac
accctgtacgtgcacggcggcgtccgcacccgcggcccgtacgcccagtacagcgacgag
cggttcatcgaggcgtgcgtcgccgacctggaggacctgctcgggcacacccgcgacgtc
gccgccctcatcgccgaacccatccagggcgtcggcggcttcaccgcgccgcccgacggt
ctgtacgccgcgttccgccaagtcctggaccggcacggcatcctgtggatctcggacgag
gtgcagaccggctggggccgcaccggcgaacacttctggggctggcaggcgcacggccag
gccggaccgcccgacatcctcaccttcgccaagggcatcggcaacggcatgtccatcggc
ggagtcgtggcccgcgaggaggtcatgaacagcctcgacgccaactccatctccaccttc
ggcggttcgcccgtcaccatggccgccgggctcgccaacctcggctacctcctcgatcac
gacctgcagggcaacgcccgccgcgtcggcggtctgctcatcgaacgcatccgggccgcc
gccgcgggcgtcgacgccgtacgcgaggtacgcgggcgcggtctgatgatcggcgtcgag
ctcacccggccgggcaccgatctcgcgcaccccgaggcggccgcggccgtccttgagacc
gcgcgtgagaacgggctcctcctcggcaagggaggcggccacaacaccagcaccctgcgc
atcgcgccgccgctctcgctcaccgtcgccgaggccgaggaaggcgcctcgatcctcgaa
caggctctgcacgcactctag

DBGET integrated database retrieval system