KEGG   Streptomyces laurentii: SLA_6343Help
Entry
SLA_6343          CDS       T05205                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
slau  Streptomyces laurentii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C HTH_53
Motif
Other DBs
NCBI-ProteinID: BAU87211
UniProt: A0A160P7X0
LinkDB All DBs
Position
complement(6671774..6672832)
Genome map
AA seq 352 aa AA seqDB search
MDLPVMPPIKPMLAKAVKKIPPGMQYEAKWDGFRAIVHRDGPEVFVGSRTGKPLTRYFPE
LVEALLGRLPERCVVDGEIVIEHGGRLDFDRLTERIHPAESRVRMLAETNPARFIAFDLL
ALGDEALLDTPLTERRAALEGALAGVDAPVHLAPATRDPELAARWFEQYEGAGLDGVVAK
PLDLPYRPDERLMYKIKHERTADVVVAGYRFHKSGPVVGSLLLGLYDDQGALQHVGVCAA
FTARRRAELVEELEPLRMDPPAGHPWAAWADASAHTSSRLPGAPSRWSGKKDLSWVALRP
ERVCEVGYDHMEGDRFRHTAQFRRWRPDRAPESCGYAQLEEPVSYDLAEVLA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggacctgccggtgatgccgccgatcaagccgatgctggcgaaggccgtcaagaagatc
ccgccgggcatgcagtacgaggccaagtgggacggattccgcgcgatcgtgcaccgcgac
ggcccggaggtcttcgtcggcagccggaccggcaagccactgacccgctatttccccgaa
ctggtcgaggccctgctcggccggctgcccgagcgctgcgtggtcgacggggagatcgtc
atcgagcacggcggacggctggacttcgaccggctcaccgagcggatccatccggcggag
tcccgggtgcggatgctggcggagacgaacccggcccggttcatcgccttcgacctgctc
gccctcggcgacgaggccctcctcgacaccccgctcaccgagcggcgggccgctctggaa
ggcgcgctggccggggtcgacgcgccggtccatctcgcccccgcgacccgggaccccgag
ctcgccgcgcgctggttcgagcagtacgagggcgcgggcctggacggggtcgtcgccaag
ccgctcgatctgccgtaccggccggacgaacgcctcatgtacaagatcaagcacgagcgc
accgccgacgtcgtcgtggccggctaccgcttccacaagagcggtccggtggtcggctcg
ctgctcctcggcctgtacgacgaccagggcgccctccagcacgtcggcgtgtgcgcggcc
ttcaccgcgcgccggcgtgccgagctggtcgaggagctggagccgctgcgcatggacccg
ccggccggacacccgtgggcggcctgggcggacgcgtcggcgcacacctcgtcccggctg
ccgggggcgccgagccgctggtcggggaagaaggacctgtcgtgggtggcgctgcgcccg
gagcgggtctgcgaggtcggttacgaccacatggagggcgaccggttccggcacaccgcc
cagttccggcgctggcgtccggaccgtgccccggagtcctgcgggtacgcgcagttggag
gagcccgtctcgtacgacctcgccgaggtcctcgcgtaa

DBGET integrated database retrieval system