KEGG   Sugiyamaella lignohabitans: AWJ20_1523Help
Entry
AWJ20_1523        CDS       T05270                                 

Gene name
GUT2
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
slb  Sugiyamaella lignohabitans
Pathway
slb00564  Glycerophospholipid metabolism
slb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:slb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AWJ20_1523 (GUT2)
Enzymes [BR:slb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AWJ20_1523 (GUT2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 FAD_oxidored GIDA HI0933_like Pyr_redox_3 NAD_binding_8 FAD_binding_3 Pyr_redox Thi4 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 30033335
NCBI-ProteinID: XP_018735718
UniProt: A0A167DSI3
LinkDB All DBs
Position
A:complement(4742679..4744685)
Genome map
AA seq 668 aa AA seqDB search
MSSTIALKTGVRLVSRSAFRSGAVRTLNRGIGSRSFSSTKSSRNSSNSGSNTAENAGSNI
FQLAALTASSVTLGASIFYFLFADEDSTRNEDHDDGAYKPFVPAPQSVPRSRDEILKSLK
NTENYDIIIIGGGATGAGVALDAITRGLKVALVERDDYASCTSSRSTKLIHGGVRYLEKA
VWHADYEQYKLVKEALHERKVFLDMAPHLSFPLPIMIPLYKWWQMPYYWVGVKCYDLLAG
KRNLESSYVLTRGKALEVFPMLNDDKLKGAVVYYDGSHNDSRTNVSVALTAQELGADVIN
HVEVTGLKKDANGKLIGIEARDLASETPETFSVSGKSVVNATGPFSDTIRKFDNQKVPEI
VVPSSGIHIVLPGWYSPKNMGLLDPATSDGRVIFFLPWQGSTIAGTTDAPCEVERNPIPS
EKDINFVLKEVKHYIDGKIDVRRDDVQAAWSGVRPLVMDPAKMGEGTQGVVRNHLVTLSD
SGLVTIAGGKWTTFRQMAQETVDTCIEQFNLSPVTATSQTEKVKLVGGEGWTPLRYIDLI
QKYNLEPEVAQHLSENYGTRAFTVAELCTPSSSPNHPRGKRIVPSYPFIDGELLYAMRYE
YATTAVDFLARRTRLAFLNSTAAFEALPSVIDVMAKELNWSKTRKDQEYEQSVEFLKGMG
LRQESDKN
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgtctagcacgattgccttgaaaacaggtgtaagattggtttccagatctgcttttagg
tctggtgctgtcaggactctcaatcgtggcattggatctcgttctttttctagtaccaag
tctagcagaaacagttcaaattctggttccaacactgctgaaaatgctggatctaatatt
tttcaattagcagctcttactgcttcttcggttactttgggtgcttctattttctacttt
ctgttcgccgacgaggattctacgagaaacgaggaccacgatgatggagcatacaaacca
tttgttcctgcccctcaatcggttcctagatctagagacgagatcttgaaatctcttaaa
aatactgagaactacgacattattattattggtggaggtgcaaccggtgctggtgttgct
cttgatgccattactagaggtctcaaggtagcccttgttgaaagagatgattatgcttca
tgtacttcatcaagatcaactaaacttatccatggtggtgtccgttacctcgaaaaggct
gtttggcacgctgattacgagcaatacaaacttgtgaaagaagctcttcacgagcgtaag
gtgttcctggacatggctccccatctttcttttcctttgccaatcatgattcctctttat
aaatggtggcagatgccttactactgggtaggtgtcaaatgttacgatttacttgcagga
aaacgtaatctcgagtcttcatacgttttgaccagaggtaaagctttagaagttttcccc
atgttgaatgatgataaattgaagggcgctgtagtttattacgatggatctcataatgat
tcaagaacaaatgtgtctgtggccttgactgctcaagagctcggtgctgatgtcattaac
cacgttgaagttactggtttgaagaaggatgccaatggtaaactcattggtattgaggct
cgtgatttggcttcagagactcctgagaccttttctgtttctggaaagtctgtagttaat
gctactggtcctttcagtgacaccatccgtaaattcgacaaccaaaaagttcccgagatc
gtcgttccttcttctggtattcacatcgtattgcccggttggtactcccccaagaatatg
ggtcttcttgatcctgctacttcagatggtagagttattttcttccttccttggcaaggc
tctaccattgctggtactactgatgctccttgtgaagtcgaacgtaatcccattccttca
gagaaagatatcaactttgttctcaaggaagtcaagcattatattgatggtaagatcgat
gttcgaagagacgatgttcaggccgcttggtctggtgttcgtcctcttgtgatggatcct
gccaagatgggtgaaggtactcagggtgtagtgagaaaccatcttgtcactttatctgat
tctggcttggtgactattgctggtggtaaatggacaacctttagacagatggctcaagag
actgttgacacatgcattgaacaattcaatcttagtccagtcactgccactagtcaaacc
gagaaagtcaaactcgtcggtggtgaaggctggactcctcttcgttacattgacttgatc
caaaagtataacttagaaccagaagttgctcaacacctttctgaaaactacggaactaga
gcatttactgttgctgagctgtgtactcccagctccagtcctaaccatcctcgcggcaag
cgcattgttccctcttatccatttattgatggtgaacttttgtacgctatgagatatgag
tacgctacaaccgctgttgatttcctggccagaagaactagattagcatttttgaactcg
actgctgcctttgaagcccttccatcagtcatcgatgtcatggccaaggaacttaattgg
tccaagactagaaaagatcaagaatatgaacaaagcgtcgagttcttgaagggtatggga
ttaagacaggagtcagacaagaactag

DBGET integrated database retrieval system