KEGG   Sugiyamaella lignohabitans: AWJ20_2469Help
Entry
AWJ20_2469        CDS       T05270                                 

Gene name
SDH2
Definition
(RefSeq) succinate dehydrogenase iron-sulfur protein subunit SDH2
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
slb  Sugiyamaella lignohabitans
Pathway
slb00020  Citrate cycle (TCA cycle)
slb00190  Oxidative phosphorylation
slb01100  Metabolic pathways
slb01110  Biosynthesis of secondary metabolites
slb01130  Biosynthesis of antibiotics
slb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:slb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AWJ20_2469 (SDH2)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AWJ20_2469 (SDH2)
Enzymes [BR:slb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AWJ20_2469 (SDH2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_7 Fer4_18 Fer4_9
Motif
Other DBs
NCBI-GeneID: 30034383
NCBI-ProteinID: XP_018737333
UniProt: A0A167F5K0
LinkDB All DBs
Position
B:complement(1443073..1443891)
Genome map
AA seq 272 aa AA seqDB search
MFKSQIAVRGASSMISRRMLSSSRVVSNAAAAAAAPVERLKTFKIYRWNPDTPEEKPYLK
EYKVDLSKTGPMVLDALLKIKNEQDATLTFRRSCREGICGSCAMNIDGRNTLACLCRIEQ
DESKDSKIYPLPHMFVVRDLVPDLTLFYKQYKAIEPYLQRDSVPEDGKENLQTIEDRKKL
DGMYECILCACCSTSCPSYWWNQQEYLGPAVLMQAYRWMADSRDLATDKRREMLQNSMSL
YRCHTIMNCARTCPKGLNPGLAIARIKKEMSF
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagtcacaaatcgctgttcgtggagcttcgtccatgatctcgcgtagaatgttg
tcatcttcgcgagttgtgagcaatgccgctgccgctgctgctgctcctgttgaaagactt
aagactttcaagatttacagatggaaccccgatactccagaagagaagccatatctcaaa
gaatataaagtggatttatccaagacaggacccatggttcttgatgcattgctgaaaatt
aagaatgagcaggatgctaccttgacattccgtcgttcgtgccgtgaaggtatttgtgga
tcatgtgccatgaacatcgacggtagaaacactttggcatgtctgtgtcgtattgaacaa
gacgaatctaaagactcgaagatctatcctttaccacacatgtttgtggtgcgtgacttg
gttcccgatttgacgctattctacaagcaatacaaggccatcgagccatacctgcaaaga
gactctgttcccgaggacggaaaggagaacttacagaccatcgaggatagaaagaagctc
gacggtatgtacgagtgcattctgtgtgcctgttgttcaacttcgtgtccttcatactgg
tggaatcaacaagaatacctcggacccgccgtgttgatgcaagcctacagatggatggcc
gactcgcgtgatctggccaccgacaagcgtcgtgaaatgctacaaaactccatgagttta
tacagatgtcacaccatcatgaactgtgcccgaacatgtcccaagggcctcaaccccggt
cttgccatcgctcgtatcaagaaggagatgtctttctaa

DBGET integrated database retrieval system