KEGG   Sugiyamaella lignohabitans: AWJ20_2732Help
Entry
AWJ20_2732        CDS       T05270                                 

Gene name
CDC9
Definition
(RefSeq) DNA ligase (ATP) CDC9
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
slb  Sugiyamaella lignohabitans
Pathway
slb03030  DNA replication
slb03410  Base excision repair
slb03420  Nucleotide excision repair
slb03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:slb00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    AWJ20_2732 (CDC9)
   03410 Base excision repair
    AWJ20_2732 (CDC9)
   03420 Nucleotide excision repair
    AWJ20_2732 (CDC9)
   03430 Mismatch repair
    AWJ20_2732 (CDC9)
Enzymes [BR:slb01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AWJ20_2732 (CDC9)
    6.5.1.6  DNA ligase (ATP or NAD+)
     AWJ20_2732 (CDC9)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     AWJ20_2732 (CDC9)
DNA replication proteins [BR:slb03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    AWJ20_2732 (CDC9)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     AWJ20_2732 (CDC9)
DNA repair and recombination proteins [BR:slb03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     AWJ20_2732 (CDC9)
   NER (nucleotide excision repair)
    Other NER factors
     AWJ20_2732 (CDC9)
   MMR (mismatch exicision repair)
    Other MMR factors
     AWJ20_2732 (CDC9)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_A_N RNA_ligase
Motif
Other DBs
NCBI-GeneID: 30034676
NCBI-ProteinID: XP_018737589
UniProt: A0A167FCC8
LinkDB All DBs
Position
B:complement(2319154..2320662)
Genome map
AA seq 502 aa AA seqDB search
MFAPKPLSVSEVFKSLTEIAKSSGASSQAKKIGIIKRMLTACKGTEPKYLVRSLEGKLRI
GMAEKSVLTALSQAFITWEFEKNGKRVKADDIQQADEIVKDVCSQLPNYEVIIEAILKDG
ILNLKDACKLTPGIPLKPMLAKPTKSITEVLDRFNGEEFTCEYKYDGERAQVHATEDGKI
RVYSRNMEDMSQRYPDIVSIVPHFMPDSKKSFILDCEAVAWDREQRKILPFQVLSTRKRK
DVEEGSIKVRVHLFAFDLLYLDGEPLLQKSLLERRELIKNNFTEVEGEFAYAKSMNSDNI
EEIQAFLDQSVKDSCEGLMVKMLNGTESGYEPSKRSRNWLKLKKDYLSGVGDSLDLVVLG
AYYGRGKRTNVYGGFLLGCYNADSEDYETVCKIGTGFSEANLEEFHKQLSTTVVSEPKSY
ISYDPTPSSLPDVWFEPTTVWEVLTADLSLSPIYKAGIQQLGRGISLRFPRFIRVREDKK
PEDATTSEQIVDFYQRQASLTN
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtttgctcccaagcccctctcagtttccgaagtatttaaaagcttgactgagattgcg
aaatctagtggtgcatcaagtcaggccaagaagattggaattataaaacgcatgcttact
gcttgtaaaggaactgaaccaaagtacctggttcgtagtttagagggaaaattgcggatc
ggcatggccgagaagtcagtactgactgcgttgtctcaagcatttatcacttgggagttt
gagaaaaatggcaagcgagttaaggcagatgacattcaacaggcagatgagattgtgaag
gacgtttgtagtcaactcccaaactatgaggtaattatcgaagccattctgaaagacgga
attctaaatttgaaagatgcctgcaagttgacacctggtattcccttaaagccaatgctt
gccaagccaaccaaatcaattaccgaagtactggacagatttaatggagaggaattcacc
tgtgaatataaatatgatggtgagagagctcaagtacatgctacagaggatggaaagatc
cgagtctactcaagaaacatggaagacatgtctcaaagatatcccgatattgtttctatt
gtaccacattttatgcccgattctaagaagagttttatattggactgcgaagctgtagct
tgggaccgtgagcaacgtaaaattcttcctttccaggtcctatctacacgtaagcgaaaa
gatgttgaagagggctcaattaaggttagagtacacctttttgcttttgatttgctatat
cttgatggtgaaccgttattgcaaaaatcgctcttggaaagaagggagctaataaaaaat
aacttcaccgaggttgaaggagagttcgcctatgcaaagtcaatgaattcagacaatatc
gaggaaattcaagcttttctagaccagtcggtaaaggacagctgtgagggactcatggtt
aagatgctaaatggcactgaaagcggttatgagcctagcaagagaagtagaaactggctg
aagttaaagaaggattatctgagtggcgtcggtgactcgttagatcttgttgttcttggt
gcctactacggtcgtggtaagagaacgaatgtgtatggtggatttttacttggttgctat
aacgcggatagcgaggattatgagacggtgtgtaagatcggtacaggattctcggaagcg
aatttagaggagttccacaaacagctgtctactacagtcgtcagtgagcccaaatcgtat
atttcctatgacccaacgccaagctcacttcctgacgtatggtttgagcctaccacagtg
tgggaggtcctaacggcagacttatcgttgtcaccaatttacaaggccggtattcagcag
cttggacgaggtatttcgcttcgtttccctcgttttatccgtgtccgtgaagacaagaaa
cctgaagatgcaaccacttcggaacaaatcgtggacttttaccagcgccaagcgtctctt
actaattaa

DBGET integrated database retrieval system