KEGG   Sugiyamaella lignohabitans: AWJ20_3189Help
Entry
AWJ20_3189        CDS       T05270                                 

Gene name
TPK2
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit TPK2
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
slb  Sugiyamaella lignohabitans
Pathway
slb04113  Meiosis - yeast
slb04138  Autophagy - yeast
slb04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:slb00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AWJ20_3189 (TPK2)
  09143 Cell growth and death
   04113 Meiosis - yeast
    AWJ20_3189 (TPK2)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    AWJ20_3189 (TPK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:slb01001]
    AWJ20_3189 (TPK2)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:slb03019]
    AWJ20_3189 (TPK2)
   03036 Chromosome and associated proteins [BR:slb03036]
    AWJ20_3189 (TPK2)
Enzymes [BR:slb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     AWJ20_3189 (TPK2)
Protein kinases [BR:slb01001]
 Serine/threonine kinases: AGC group
  PKA family
   AWJ20_3189 (TPK2)
Messenger RNA biogenesis [BR:slb03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     AWJ20_3189 (TPK2)
Chromosome and associated proteins [BR:slb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    AWJ20_3189 (TPK2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like TFIIA Seadorna_VP7 Miga DUF4871 YrbL-PhoP_reg
Motif
Other DBs
NCBI-GeneID: 30035183
NCBI-ProteinID: XP_018738038
UniProt: A0A167FQA5
LinkDB All DBs
Position
B:complement(3550561..3552222)
Genome map
AA seq 553 aa AA seqDB search
MHKRILNKLNPAQHKKRDNLTSSDLDTTSASSQSQSQPHSSQSHFLSHTSTSHTSQSSHS
QQSQSQSQSQSHALSSPISSLSSNSTTASNPSTMSSAHQVPGTVPGTVSGAVPVVTGQPQ
PQQALLVDHQAVSHQQQPQQHVPVGHDIHSQPAVDAHQQQQQQQQQQQQHYQQLHQQQAD
QQAQQHQQQQQQLPHQDQQTIQSHGQVAASPANTAAITSVAGNHSLLPKRSTVSKGKYSL
SDFQIQRTLGTGSFGRVHLVRSIHNGRFYAIKVLKKAQIVKMKQVEHTNDERRMLKLVEH
PFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLHSH
NIIYRDLKPENILLDKNGHIKITDFGFAKEVSDVTWTLCGTPDYIAPEVVTTKAYNKSVD
WWSLGILIYEMLTGYTPFYDQTPMKTYENILVGNVRYPPYLHPDVTDLLQKLITKDLTRR
LGNLQGGSSDIKSHPWFSEVIWEKLLSKDIETPYEPPIQSGVGDTSLFDRYPEDELDYGI
SGPDPYSDLFTDF
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaacgcattttgaataaactcaatccagctcaacataaaaagagggataatctg
acgtcgtccgatctcgataccacttctgcttcgtcccagtctcaatcccaaccgcattcg
tcccagtctcattttctgtctcatacttctacctcgcacacgtctcagtcgtcgcattct
cagcagtcgcagtctcagtcacagtctcagtcgcacgccctgtcgtcgcctatttcgtcg
ctatcgtcaaattctactactgctagtaatccctcgacaatgtccagtgctcatcaggtt
cccggtactgttccaggtaccgtttcaggtgctgtcccagttgtaactggccagccacag
ccacagcaggctctgttggtagaccatcaggctgtctcgcatcagcagcagcctcaacaa
catgtgccagttggccatgatatccattctcagcctgctgtcgatgctcaccagcaacag
caacagcaacagcagcaacaacaacaacattatcagcaacttcaccaacaacaggcagac
caacaggctcaacaacatcaacaacaacaacaacaattgcctcaccaggaccagcaaaca
attcaaagtcatggtcaagtggctgcttctcctgctaataccgctgccattacttctgta
gctggcaaccacagtcttcttcccaagagatcgactgtttcaaagggtaaatactcactt
tcagatttccaaatccaaagaactcttggaactggctcgtttggaagagttcacttggtt
cgcagtatccataatggccgtttctacgccatcaaggttttgaaaaaggcccagatcgtg
aaaatgaaacaggtcgaacacaccaatgacgaacgtcgtatgctcaagcttgtagaacac
ccgtttttgattagaatgtggggtactttccaggactctagaaacctgtttatggttatg
gattatattgagggtggtgaattgttctctttgttgagaaaatctcaacggtttcccaat
cctgtcgctaaattctatgctgccgaagtcactttggctttggaataccttcactctcac
aatatcatctaccgtgatcttaaacccgagaacattttgcttgataagaatggacatatc
aagatcaccgatttcgggtttgccaaggaagtatctgatgttacctggactctttgtgga
actcctgattatatcgctcctgaggttgtcactaccaaggcgtacaacaagtcggttgac
tggtggtccctaggtattctcatctatgaaatgctaactggatatactcctttctacgac
cagacgcccatgaaaacatatgaaaacattcttgttggtaatgtgcgctacccaccttac
ctgcaccccgatgtcacagacctgctgcaaaaactcatcacaaaggatctgacccgtcgt
cttggtaatttacagggaggctccagtgatatcaaatcgcacccttggttcagcgaggtc
atttgggagaagctgctgtccaaagacattgaaaccccctacgaaccacccatccaatct
ggcgtcggtgacacctcgcttttcgaccgctaccctgaggacgagctcgactacggtatc
agcggccccgacccctacagtgacctctttaccgacttctga

DBGET integrated database retrieval system