KEGG   Sugiyamaella lignohabitans: AWJ20_367Help
Entry
AWJ20_367         CDS       T05270                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase GAD1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
slb  Sugiyamaella lignohabitans
Pathway
slb00250  Alanine, aspartate and glutamate metabolism
slb00410  beta-Alanine metabolism
slb00430  Taurine and hypotaurine metabolism
slb00650  Butanoate metabolism
slb01100  Metabolic pathways
slb01110  Biosynthesis of secondary metabolites
Module
slb_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:slb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AWJ20_367 (GAD1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AWJ20_367 (GAD1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AWJ20_367 (GAD1)
   00430 Taurine and hypotaurine metabolism
    AWJ20_367 (GAD1)
Enzymes [BR:slb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AWJ20_367 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 30035716
NCBI-ProteinID: XP_018734606
UniProt: A0A167CUR4
LinkDB All DBs
Position
A:1182000..1183661
Genome map
AA seq 553 aa AA seqDB search
MSLSDDVNAETLLAKLQKTTPDSAVGLRAGNQNTTEGSHDLARYIHEPIPKFRMQEAAID
KRIVASVIRSELDLDGIPSLNLASFVNTFIEEPALSLLADNIGKNLADGDEYPALQTIHQ
RCVAILSNLWNVPKGELGVGTATTGSSEAIHLGGLAMKRRWEAAQRAKGRDIKGVTPNII
MGSNAQVALEKFARYFDVTARLLPVDAENSYGFNPQDLKKTVDENTIGVFVIAGSTYTGH
YQDVEAVSDVLDEIEKETGISVDIHVDGASGALVAPFVTPSLKFDFRIDRVKSINTSGHK
FGLVTVGLGWIIWRDRKYLPEELLFTLHYLGGSEDTYTLNFSRPGFPVIHQYYNFVSLGL
EGYRNLHSASLANARLFATFLEATGYFEVLSDIHRPKGVHSYTGKPSDITNQDPEFYNPG
LPVVSFRFSKSFREQYPMIPQQAVSTLLRVRGYIIPNYPMPADLEDIEVLRVVVRASLSV
DILDMLMEHIVATVQKLTSSVKDHYTAETESDKLYKTLLALTTSNPLDSEHPQYWDFQEE
TGTRSGHSHGTKC
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgtctctctctgacgacgtcaacgctgaaaccttgctggccaagcttcagaaaaccact
cctgattcggccgttggtctgcgtgctggaaaccagaacaccaccgaaggttcacacgac
ttggctcgttatatccatgagcccattcccaagttccgtatgcaagaggctgcaattgac
aagcgcattgttgcgtctgtcatccgttctgaacttgatttggacggtatcccttcactc
aacttggcttcctttgtcaacaccttcattgaagagcctgctttgagtttgctcgctgac
aatattggcaagaacttggctgatggtgacgagtaccctgctttgcaaaccattcaccaa
agatgtgttgctatcttgtccaacctctggaacgtccccaagggcgaattgggtgttggt
actgccactactggttcttctgaagctattcacttgggaggtttggccatgaagagacgt
tgggaagctgctcaaagggctaaaggaagagatattaaaggcgtcactcctaacatcatc
atgggatccaatgcccaagttgctttggagaagtttgcccgttactttgacgtcactgcc
agattgttaccagttgatgctgaaaactcgtacggattcaatcctcaggacttgaaaaaa
actgttgatgaaaataccattggtgtttttgtgattgccggttctacttatactggacac
taccaagacgtcgaagctgtttctgatgttcttgatgagattgagaaggagactggtatt
tctgttgatatacatgtcgatggtgccagtggtgctcttgttgctccttttgtgactccc
agtctcaagttcgatttccgtattgatcgtgtcaagtccatcaataccagtggccacaag
ttcggtcttgtcactgtaggattgggctggatcatctggagagatcgtaagtacctccct
gaagagctcttgtttactctccactatttgggaggaagtgaagacacctacactcttaac
ttctcgagacctggtttccccgtcattcaccagtactacaactttgtcagtctcggactc
gagggctacagaaacctgcacagtgcttcgctcgccaacgcccgtttgtttgccactttc
cttgaggccactggatactttgaggttttgagtgatatccacagacccaagggtgtacac
agttacactggaaagccctcggatatcaccaaccaggaccccgaattctacaatcccggt
cttcccgttgtgtcattccgtttctccaagagtttcagagaacagtatcccatgatcccc
caacaagctgtctcgactcttctgcgtgttcgaggctacatcatccccaactaccccatg
ccagccgacctcgaggacatcgaagtgctccgagtggtggttcgagcctcgctctcggtc
gacatcctcgatatgctcatggaacacatcgtggccaccgtgcaaaaactcacctcgtcg
gtcaaggaccactacaccgccgaaaccgagtccgacaagctctacaagaccctgctggcc
cttaccacgtcgaatccactcgactcggaacaccctcaatactgggacttccaggaggag
accggcacccgaagcggccactctcacggtaccaagtgttaa

DBGET integrated database retrieval system