KEGG   Sugiyamaella lignohabitans: AWJ20_3815Help
Entry
AWJ20_3815        CDS       T05270                                 

Gene name
GPM1
Definition
(RefSeq) phosphoglycerate mutase GPM1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
slb  Sugiyamaella lignohabitans
Pathway
slb00010  Glycolysis / Gluconeogenesis
slb00260  Glycine, serine and threonine metabolism
slb00680  Methane metabolism
slb01100  Metabolic pathways
slb01110  Biosynthesis of secondary metabolites
slb01130  Biosynthesis of antibiotics
slb01200  Carbon metabolism
slb01230  Biosynthesis of amino acids
Module
slb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
slb_M00002  Glycolysis, core module involving three-carbon compounds
slb_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:slb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AWJ20_3815 (GPM1)
  09102 Energy metabolism
   00680 Methane metabolism
    AWJ20_3815 (GPM1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AWJ20_3815 (GPM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:slb04131]
    AWJ20_3815 (GPM1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:slb04147]
    AWJ20_3815 (GPM1)
Enzymes [BR:slb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     AWJ20_3815 (GPM1)
Membrane trafficking [BR:slb04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    AWJ20_3815 (GPM1)
Exosome [BR:slb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   AWJ20_3815 (GPM1)
  Exosomal proteins of melanoma cells
   AWJ20_3815 (GPM1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 30035878
NCBI-ProteinID: XP_018733496
UniProt: A0A167BZH5
LinkDB All DBs
Position
C:complement(345007..345756)
Genome map
AA seq 249 aa AA seqDB search
MSTHKLILVRHGQSDWNEKNLFTGWVDVKLSEVGIKEATRAGELLKESGLKPDILYTSKL
SRAIQTANIALDNADRLFIDVKRNWRLNERHYGALQGKDKAQTLAQYGKEQFMTWRRSFD
VPPPPIADDSEFSQAHDERYKDVPKEDLPKTESLELVIKRLLPYWQSDISKDLLAGKTVI
VVAHGNSLRALVKHLDNISDEDIAGLNIPTGIPLVYELDDNLKPVKKAEYLDPEAAEAGA
AAVAAQGSK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtccactcataagctcatcctcgtccgtcacggtcaatctgactggaatgaaaagaac
cttttcaccggttgggtcgatgtcaagctctctgaagtcggtatcaaggaggccactcgt
gctggtgagctcttgaaggagtccggccttaagcccgatattctctacacttctaagctt
tctcgtgctattcaaactgccaatattgctcttgacaatgctgaccgtcttttcattgat
gtcaagcgtaactggcgtcttaacgagcgtcactacggtgctttgcaaggaaaggacaag
gctcaaaccttggcccaatacggcaaagagcaattcatgacttggcgtcgttctttcgat
gttcctcctccaccaattgctgacgactctgagttttctcaagctcacgatgaaagatac
aaggatgttcctaaggaggaccttcccaagactgagtctctcgagttggtcatcaagcgt
ctgttgccttactggcaatctgatatctccaaggatttgcttgccggtaagaccgttatt
gtcgttgcccacggtaactccttgagagctttggtcaagcacctcgacaacatctctgat
gaagatattgctggtcttaacatccctactggtattcctcttgtctatgaacttgatgac
aacctcaagcctgtcaagaaggctgagtacctcgaccctgaggctgctgaggccggagct
gccgccgttgctgcccaaggttctaaataa

DBGET integrated database retrieval system