KEGG   Sugiyamaella lignohabitans: AWJ20_3918Help
Entry
AWJ20_3918        CDS       T05270                                 

Gene name
PHO8
Definition
(RefSeq) alkaline phosphatase PHO8
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
slb  Sugiyamaella lignohabitans
Pathway
slb00730  Thiamine metabolism
slb00790  Folate biosynthesis
slb01100  Metabolic pathways
Module
slb_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:slb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    AWJ20_3918 (PHO8)
   00790 Folate biosynthesis
    AWJ20_3918 (PHO8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:slb04147]
    AWJ20_3918 (PHO8)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:slb00537]
    AWJ20_3918 (PHO8)
Enzymes [BR:slb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     AWJ20_3918 (PHO8)
Exosome [BR:slb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AWJ20_3918 (PHO8)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:slb00537]
 Enzymes
  AWJ20_3918 (PHO8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 30035992
NCBI-ProteinID: XP_018733597
UniProt: A0A167C1X7
LinkDB All DBs
Position
C:complement(682735..684348)
Genome map
AA seq 537 aa AA seqDB search
MADETLLPAWRRGGRSQEHNKTMVFLGIWATLATFLALYYSPGHFSDLFKSHQSPKRNVI
FFVSDGMGPASLSLTRSFRQYRDNLPIDDILHLDDHFIGHSRTRSSDSLVTDSAAGATAF
ACGFKTYNGAIGVFPDTDPCGTVLEGAKLRGYHTGMVVTTRITDATPASFSAHVLHREEE
DLIAEHQLGMYPLGRMVDLMIGGGRCHFLPGSVDGGCRHDSRNLVEEAVEDGWQYVENRE
QYDLLKGGNNISLPLLALLAPGDIPYDLDRDDSVYPSLEDTTRTAIRALELATKHSDKGF
FLLVEGSRIDHAGHQNDPAAQVREVLAFDRAFQAAIEFSKKSNVETIVVSTSDHETGGLA
TARQLTPSYPDYLWYPEALDNATHSAEYLGHALRHYNGKDVYDFIKTDILKEGLGIPEPT
EEQIKLLADNKKRSEDHIANIISLRSQTGWSTHGHSAVDVNVYGFSGHKRANRRILKTLG
GSNENTDIGKFLADYLDVDVSKVTDLLQQDDITTDDLDDPHGLDSYHAHIMAVTNGL
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgaaacactactgcccgcctggagaaggggcggtcgcagccaggagcacaat
aagaccatggtatttttaggcatatgggctaccctggcaacctttttagcattgtattac
agtccaggccacttttcagatcttttcaagtcccaccagagccctaaacgaaatgttatc
ttctttgtgtcagatggtatgggacctgcttcgttgtctttgactagaagtttccgtcaa
tatcgagacaatttgccaattgatgacattttgcacttggacgaccattttatcggtcat
tctagaacgagaagcagtgatagcttggtaactgatagtgccgctggagccactgccttt
gcctgtggattcaagacatataatggagctattggtgttttcccagatactgatccttgt
ggtaccgtgttagaaggagctaagttacgtggttatcatactggtatggttgtcacaacc
cgtatcactgatgccacacctgcttctttctcagcccatgtgttgcacagagaagaggag
gatctcattgccgagcaccaactgggtatgtatcctttaggcagaatggtcgacttgatg
attggtggtggcagatgccactttttgcctgggtcagttgatggtggctgtcgtcatgat
agtagaaatcttgttgaagaagctgtggaggacggctggcaatatgttgagaatcgtgag
caatacgatttattgaagggcggtaacaacatttcgctgccattattggcgttactggcc
cctggcgatattccatatgatcttgatagagacgactctgtatacccaagtttggaggac
accactagaactgctatccgtgcattagagttggctactaagcactctgataagggattc
ttccttttggttgagggatcgagaatcgaccatgccggtcatcagaatgatcctgctgct
caagtacgcgaggtgctggcttttgacagggctttccaggctgctattgagttctccaag
aagtctaatgtcgagaccattgtcgtcagtacctctgaccacgaaactggtgggttagct
actgctcgccaattgactccttcctaccccgattatctgtggtatcctgaagctctggac
aatgccacccattctgcggaatacttgggtcatgctctaagacattacaatgggaaggat
gtatatgattttatcaagactgacattctgaaagagggtctgggtattccagaaccaaca
gaagaacaaattaagcttctggctgataacaaaaaacggtctgaagaccacattgccaat
attatctctctgagatctcagaccggctggagtacccacggccactcggcagtcgacgtc
aatgtgtacggattctcgggacacaaacgggccaaccgtcgtatcctcaagaccctagga
ggtagcaacgagaacaccgacattggcaagttccttgccgactacctcgacgtcgatgtg
tccaaagtgacagaccttctccaacaagatgatatcaccactgacgacctcgacgaccca
catgggctcgactcttatcatgcccacatcatggctgtcaccaacgggctctag

DBGET integrated database retrieval system