KEGG   Sugiyamaella lignohabitans: AWJ20_4004
Entry
AWJ20_4004        CDS       T05270                                 

Gene name
NUP116
Definition
(RefSeq) FG-nucleoporin NUP116
Organism
slb  Sugiyamaella lignohabitans
SSDB
Motif
Pfam: Nucleoporin_FG
Other DBs
NCBI-GeneID: 30036089
NCBI-ProteinID: XP_018733679
UniProt: A0A167C4E3
LinkDB
Position
C:complement(927802..928641)
AA seq 279 aa
MFGNTNRVGGFGTSNTTNTTGSGGLFGSSPSTGAFGSSTTGQATSPFGQAASSTGGTGLF
GQTTNNSGGGLFGSSTSGQTSNVFGSANSANNASSTSPFGQANTGASGGLFGATKPTTGF
GGFSNTATNSSPFGQSTAATSFGSSANNNQNQGTSVVPFEPFSEKDTTKANMSNYYQSIT
SMPQYQNFSFEVSIRYYIYNGPIIELVLRIYSLKLHKFNHRYGNHKIVQLNCGPTSCFQL
TVNGLNGQKISSKFDSLLTHKGIEVSGLSTKSSLWKRWC
NT seq 840 nt   +upstreamnt  +downstreamnt
atgtttggtaacaccaaccgcgtaggaggatttggtacctcaaatactaccaacacgaca
ggatcgggtggattgtttggatctagtcctagtactggtgccttcggctctagtactaca
ggtcaggcaacttcgccttttggtcaggctgctagctctactggtggcactggtctgttt
ggtcaaactaccaataactccggaggtggtttgtttggttcatccacctcaggacaaaca
tccaatgttttcggttctgcaaattccgctaacaatgccagctctacttcgccatttgga
caagccaatactggtgccagcggaggtcttttcggagcgactaagcctacaactgggttt
ggcgggttctcgaacacggctacaaacagttcaccttttggccagtcgacggctgctact
agttttggatcatctgccaataacaaccagaaccagggaacttccgttgttccttttgaa
cctttttcagaaaaagatacaacaaaggccaatatgtccaattattatcaaagtattaca
tcaatgcctcagtaccaaaacttttcgtttgaggtaagtatacgatattatatctacaat
ggaccaattattgaattagtcctgcgtatatatagtttaaagctccataagtttaaccat
cgctatggcaatcataagattgtgcagttaaactgtggccccacgagctgtttccaattg
acagttaatggcttgaatggacagaaaatttcgagtaaatttgattccctactaacacat
aaaggaattgaggtatcaggattatcaacaaagtcgtcgctttggaaacggtggtgctaa

DBGET integrated database retrieval system