KEGG   Sugiyamaella lignohabitans: AWJ20_4030Help
Entry
AWJ20_4030        CDS       T05270                                 

Gene name
SGA1
Definition
(RefSeq) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
slb  Sugiyamaella lignohabitans
Pathway
slb00500  Starch and sucrose metabolism
slb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AWJ20_4030 (SGA1)
Enzymes [BR:slb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     AWJ20_4030 (SGA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-GeneID: 30036118
NCBI-ProteinID: XP_018733705
UniProt: A0A161HIX5
LinkDB All DBs
Position
C:complement(1042292..1043908)
Genome map
AA seq 538 aa AA seqDB search
MLVEKFLILLASCSVTSSLPIYESLSSFVGFTSPDEQKLLNGVDATRSSSSKGGHRVPGS
LINEIEYEDWLKTETDLAFDRVISNIGGYGQGLDDVLPGAVIASPSKSKPNYYYIWTRDA
AISINSLITRYDDQKGQNETLRSIINDYLNSSAIMQHVDNPSGTFENLEGLGEPKFMVDG
RPFTSTWGRPQRDGPPLRASTMINYVNSEVRNNNLQYKDFEDLYYNVIRPDLDYVVQHWK
DKSFDLWEEVYGNHFFTSMVQLKSLIHGAEIAHELGDKISFYVFRGVASELREYIRQYWD
SSRKHLVETLDSKERSGLDTALFLGSIHAIDLYNWDGIDTDELVFPPYSDEVIASIDHLV
NDMRYRFPINARRLDEFSKQGKNNSLAGVGIGRYPEDVYDGADVTTGNPWFLCTATVSQT
LYLLADHLITRPDSYKLVISDITKPFYSLFLSDNENFDSPDFSIARTNEAYTALVKRIIE
YADSFLDVIREHHANDGSMSEQFSRYDGYMRGATHLTWSYSAFWAASRQRNLTLSRLY
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgctggtggaaaagtttttaatattactggcatcgtgtagtgtaactagttcgttacct
atttatgagtcgctttcgtcgtttgttggattcacaagtcccgacgagcaaaagctgtta
aatggagtagacgctaccagaagcagtagtagtaaaggtggccatagagttccgggatcg
ctcattaatgaaatagagtacgaagactggttgaaaactgagacagacctggcgttcgac
agagtcatttctaatatcggcggctacggtcagggtcttgacgatgtccttcctggagcc
gtaatagccagcccatctaaatccaagcctaactattattatatttggactagggatgcc
gctatctccatcaactcattgattactcgttacgacgatcaaaagggccaaaatgaaaca
ctaaggtctattatcaacgactaccttaactcatctgcgattatgcagcatgtggataat
cctagtggcacatttgagaacctagaaggtctaggagagcctaaatttatggttgatgga
cgtccttttacaagcacatggggcaggccccaacgagatggtcctccccttcgtgcttcc
acgatgataaattatgtcaactctgaagtgcgtaataataatttacagtataaggacttt
gaagacctgtattacaatgtgatccgtcctgatttagactacgtagtccaacattggaag
gacaaaagcttcgatctatgggaagaagtgtatggaaaccactttttcacttcaatggtg
cagctgaaatctctcattcacggtgctgagatagcccacgagctaggcgataagatctca
ttctacgtgtttagaggcgtggcctctgaactccgtgagtacattagacagtactgggac
agctctagaaagcatttggtagagacattagattctaaagaaaggtcaggcttagacact
gcgctgttccttggttcgatacatgccatcgacctgtacaactgggatggtatagatact
gatgagctcgtgttccctccatattcggacgaggtgatcgcttccattgatcatcttgtg
aatgatatgcgttatagattcccgatcaacgccagacgtttggatgaattctctaaacag
ggcaaaaataattcccttgctggtgtgggtatcggtagatatccagaggacgtttacgat
ggagctgatgtcaccactggaaacccatggttcctttgcacggcaactgtttcccagact
ctttaccttctggccgaccatctcatcacccggccagattcgtataaattagtcatctcg
gacattaccaaacctttctattcgctatttcttagcgacaatgaaaacttcgactcgcct
gatttcagcattgctcgtaccaacgaagcatacactgcgctcgttaagcgcattatagaa
tacgcagactcgtttttagatgtaatccgtgaacaccacgccaacgacggtagtatgagt
gagcaatttagtaggtacgatggctacatgagaggtgctactcatctcacctggagttac
agtgcattctgggctgcttcgcgccagcggaacctgactctctcacgtctctattag

DBGET integrated database retrieval system