KEGG   Sugiyamaella lignohabitans: AWJ20_4114Help
Entry
AWJ20_4114        CDS       T05270                                 

Gene name
PEX7
Definition
(RefSeq) Pex7p
  KO
K13341  peroxin-7
Organism
slb  Sugiyamaella lignohabitans
Pathway
slb04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:slb00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AWJ20_4114 (PEX7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40 CHU_C
Motif
Other DBs
NCBI-GeneID: 30036211
NCBI-ProteinID: XP_018733787
UniProt: A0A167C7B0
LinkDB All DBs
Position
C:1316743..1317897
Genome map
AA seq 384 aa AA seqDB search
MLKFRTSGFSGYSVAYSPFYDSKIAVATAANFGLVGNGRLYVLDIGGDGVIRPQAQFDTQ
DGLFGLSWSESHENHIITANGDGSLKLFDITTKQQFPLQVYHEHSREVFSVNWNMKDKTI
FCSGSWDGTIKVWSPGHCSNSVMTFNANINQTNIGPGTGPCAVDGPGAAAMAATVPLLRS
EGAGTPQQQQQQQALRKSAANCVYSAKFSPYEPTIIASTHSDSSLKVWDTRQSAGSGHPV
LSIPEAHLGGDCLSVDWNKYRPTVLATSGVDKAIKIWDTRNARSPINDLRGHEYAVRSVS
WSPHSGDTLLSTSYDMTARVWRDTSASPNQAPHNPRFNPTKGLQKVFGAHTEFVFDCDWS
MWGQPGWVATTGWDEMVYIWHAES
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaattccgaacgagtgggttcagtggctactcagtagcgtactcgccattctat
gactctaagattgcggtagctacagccgccaatttcgggcttgtgggtaatggacgactg
tatgtgctcgatattggaggcgacggagtgattcgtccgcaggcacaattcgatactcag
gatggtctgttcggcctttcctggtcagagtctcatgaaaatcatataataactgccaat
ggagacggcagtctcaagttgtttgatatcaccaccaaacagcagttcccactccaggtg
tatcatgaacattcaagagaggtgttcagtgtcaattggaatatgaaagataaaacaatt
ttctgctctggatcttgggatggaactattaaagtatggtcaccaggtcattgttctaat
tcagtgatgacgttcaatgccaatatcaaccagacaaatatcggtcctggaactggtccg
tgtgctgtggatggaccaggcgccgctgcaatggctgctactgttccattactaagatct
gaaggagcaggaacacctcaacaacagcaacaacaacaagccctgcggaaatcggctgct
aactgtgtatacagtgccaagttctcgccctatgaaccgactattattgcatctacacat
tccgactcgtctctcaaagtatgggacactcgacagtcggctggttcaggccatcctgtt
ttaagcattcctgaagcacatcttggaggagactgtttatcagttgactggaacaagtac
cgaccaacggtgctggcgacatctggtgttgacaaagctatcaaaatatgggatactcga
aatgcccgttcgccaatcaacgacctgcgaggccacgagtacgctgtgcggtctgtatcg
tggtcacctcattccggagacacacttctatcaacttcatacgacatgaccgccagagtc
tggcgcgataccagtgcatcacccaaccaagctcctcataacccacgcttcaaccccacc
aaggggctccaaaaagtgttcggagcacacaccgagttcgtcttcgactgcgactggagc
atgtggggccaacccggctgggtcgctactacaggctgggacgaaatggtctacatctgg
catgcggagtcctaa

DBGET integrated database retrieval system