KEGG   Sugiyamaella lignohabitans: AWJ20_4120Help
Entry
AWJ20_4120        CDS       T05270                                 

Gene name
DOP1
Definition
(RefSeq) Dop1p
Organism
slb  Sugiyamaella lignohabitans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dopey_N ERO1
Motif
Other DBs
NCBI-GeneID: 30036218
NCBI-ProteinID: XP_018733793
UniProt: A0A167C7I3
LinkDB All DBs
Position
C:1347097..1352190
Genome map
AA seq 1697 aa AA seqDB search
MPHSPTNKPDPKWKQFVSAVDRALATWESVQEWADYISFLGKLHRALKGGQGQAFVQIPS
ARIVAFRLATCLDPGLPSGVHQKTLEVYNSVFDILNGQELHFQIHLWLPGLLPLMSYGSI
NVKPLLIELFERHILPLPSLRSILKPLLLSFLPGIDDETSESFDEVLKLIEDIKLKVNDD
SHFWQCLFLVIISSKDRRPGALIWANRKFPSFAAISQSIDVDSLVGNIPAAYQALSYDAQ
MAVSPETGLLMRAFSRGLQDEHLLVQRGFLELLVKNLELQSPVLQAIASKDDLKLLVISA
CSTVLRRDMSLNRRLWIWLLGPEPITTDSPSSGPHYSRAEYFAKFALEPLTTGLLEMIES
DPEVPAERTRPYKICLSILDRWEIGTSVVPKILLPVIKSVQRYSNANRSDAEYEEVLRSA
GALFDGVEAINIWSDVLNLILSGGDENMQLVLFILQVFNIRDEEMIVNHLPMILLALLYK
EDRSDVWFKITSLILDAIPDRAFLPIHHADQTVNDESNASPLERIQEYYKLTSDEAVLPF
SPGTLSLLLLNRLAELTQSELEKLHQSHSNQIDSAVDVYITANGPSETGSNTVDSAETAA
TSNNEDDASASAGAGELAALLSSLLEKIPEQQSWRNHGLVNALINLGQPISYTTLSGVIT
LFITIYDSFNEEEVDEFLFSIAKVLFAQLSTSSNKHQVEIVQAIWAIQEKLDDQRVESAL
VTVVSEPGHDPLIKVRVFSILWQHSINRVNAKVILERYLFFVLDLLSEEDDGGDIATLVH
HWLKCVVTSGTAKQLLDFIIIHLLETNESGDIRSVIYYLDTLIRVLSSNAALRSTYANEE
LTGKKYPLVIFHEIERIMYRSADSNDRDSQHALNSCLELLDITEVKQESRLLDHSMLLLS
VLGYFYGSRDIESLPQVSILRLLSKFLLQLNNVSPIWKQIYSSDLFAAENTDSGRDEVAK
KSLPKTLFQCLVNGLSSSKNEYVVRAWADFLKDILPLFGQGVIQVIIPLVECLCKAISQS
FDETRSSLFENKSDKNKSIETAVFYPYMDALEHLLVTAHEKVDSQDWRGVSAKNNNDPSF
FGNVISGVFAVESPISRPAAANDRLTVLLCFQDAVRTSYNVWKCAEQSCKPSHDPTDSVV
FVLSPLKSRSRKLLAKLYSLETLEMLECFIELSRSSGGDVFKVLHVLDGSRPKLTIPYLF
NALISRMNSSSLEPADKSTLTTDLTDTEIMEFLINYLKSLENDTIEEVWYECMGFVREVY
NNQSLYRMVIPSVLRFTAKMAEKVDAVKFGSQRKVRKDLSDLFLKLLHFALNTRSAVTVE
ANITNGETVSTGATGASAPALSEKDIDDGSVDTSVPSTPHMSSSTTSLALQYNQGTSGSS
SLKQEDLIKALEQIVPSLRLIINDQDKTLTAITSITTNLVTPALRQKNYSNVSPSLMSLL
KTITHLPSTLKAWKGIVGDAFLDPRFLGISMSQASELWQPVISKWSQFDKERIKDYVSRI
SSYGTNSNVLFNWSDQESSIQSQNLDRLAYLFICGTGDGFAFSFKDLMTKFELLSVGRNT
QHVYLCLRAIILSVDPSHLAPVWTFLYSHLSSTFLDFLDQDKNVDLETLVAACRLLDTTL
VLNPEEFQSYEWLFISDSMDAIFRNEDRDPSGIVDRISASKLLPPAQTVSGWRAYLPPAA
GAPPQTPWLLSLRSSRC
NT seq 5094 nt NT seq  +upstreamnt  +downstreamnt
atgccccactccccaactaacaaaccagatcccaagtggaaacaatttgtgtcagccgtt
gaccgggcccttgcgacttgggagagtgttcaggaatgggctgattatatctcattttta
gggaaattgcatcgtgcgttgaaaggtggtcagggccaggcgtttgttcagatcccgtcg
gctcggatcgtggcgtttaggctcgctacttgtttggatcctggtctgccttcgggggtt
catcagaagactttagaggtttataattcggtttttgatatcttgaatggccaggaattg
cattttcagatccatttatggctgcctggcttgctgcctcttatgtcgtatggcagtatc
aatgttaaacctctgttgatagaactgtttgaacgccatattctgccgcttccttcttta
aggagtattttgaagccgctgttattgtcgtttcttccgggaattgatgatgagacaagt
gaatcttttgacgaggtgctgaaacttattgaggatatcaagttaaaggtaaatgatgac
tcgcatttctggcagtgtctgtttttggtaattatttcttctaaagatagacgaccgggt
gctttgatttgggctaatcgtaagtttccgtcatttgctgctatatctcagtcaattgat
gttgacagcttagttggaaatatcccggctgcataccaggcacttagttatgatgctcag
atggcggtcagtccagagactggtctgttaatgagagcgtttagtagaggattacaggat
gagcatttattagtacaaagaggttttttggagttattagttaagaatttggaactacag
tcgcctgttttacaggccattgcatctaaagacgacttaaaactgctggttataagtgct
tgttcgactgtacttcgtagggatatgtcccttaatagacggttatggatctggttgtta
ggacctgaaccgatcacgactgattctccgtcgtcaggaccccattattcacgagcagag
tatttcgccaagtttgcacttgaacctttgacaacaggacttctggagatgattgagagt
gacccggaagttcctgctgagagaactagaccatataagatttgtttgagtattcttgac
agatgggaaattggtacgtcagtagtgcctaagattctgttacctgttattaagagtgtt
caacggtacagtaatgcgaatcgatcggatgctgaatatgaagaagttcttcgtagtgcc
ggtgccttattcgatggtgtcgaagctattaatatctggagcgatgtgttgaacttgatc
ttgtctggcggtgatgaaaatatgcagctggtcttgtttatactccaggtgtttaacatt
cgggatgaagagatgattgtaaaccatctgcctatgatcttgctggctttgctgtataaa
gaagatcggtctgatgtgtggtttaaaatcacctctttgattctggacgctattcctgac
agagcatttctgccaattcaccatgctgaccagactgttaatgatgagtccaatgcaagt
ccgttggagaggatccaggaatattacaagctgacgtcagatgaagcggttctgcctttt
agtcctggtactctgtcgcttttactgctgaacaggttggctgaattgacccagtctgaa
ctggaaaaacttcaccagagtcacagtaatcaaattgattcagctgttgatgtttatatt
actgctaacggccctagtgaaactggtagtaacactgtggatagtgctgagaccgcagca
acaagtaataatgaagacgatgcttctgccagtgctggcgctggtgaactggcagcattg
ttgtcaagtcttctagaaaagattcctgagcagcaatcttggcggaatcacggcctagta
aatgcactgattaatcttggccaaccaattagctacacaactctatcaggtgtgattact
ttatttattactatctacgactcgttcaatgaggaagaggttgatgagtttttattttcc
attgccaaagtcttatttgcacagttgtctacttcctccaacaagcaccaggtagaaatt
gtccaagccatttgggctatacaggagaagctcgatgaccagcgtgtcgaaagtgctttg
gtaacagtcgtttctgaaccaggtcatgatcctctaataaaagttcgcgtattttcaatt
ctttggcaacattctatcaacagagtgaatgctaaagtcatacttgaacggtatctgttt
tttgtgctcgatctgttgtctgaggaagatgacggtggtgatattgcaactctagttcat
cactggctaaaatgtgttgtaactagtggaactgccaaacaactcctcgattttatcatt
attcatttactggagacaaatgagagtggtgatatcagatcggttatctactatcttgac
acgctaataagagttctcagttccaacgctgcccttcgcagcacctatgcaaatgaggaa
ctaacgggcaaaaagtatccactagtgattttccacgaaattgaacgtatcatgtaccgg
tctgccgattctaatgaccgcgattctcaacatgctctaaacagttgtttggaattactc
gacataaccgaggtgaagcaagagtcgcgtcttttagaccactcgatgcttcttcttagc
gtgttagggtacttttatggttctcgtgacattgagtccctacctcaggtatcaatccta
cgactcttgtccaaatttctgttacagctaaataacgtgtctcctatttggaaacaaatc
tactccagtgatttgtttgctgccgagaataccgattctggccgtgacgaggtggcaaag
aaatcactccctaaaactctattccagtgcctagtaaatggcctctcatcatccaaaaat
gagtatgtcgtccgagcatgggctgatttcctaaaggatattttgccattatttggacaa
ggcgtcatccaagtcattattcctttggtggaatgcttgtgcaaggcaatcagtcagtct
tttgatgagactcgctcgtctctatttgagaacaagagcgataaaaacaagagtattgaa
accgcagtgttctatccgtatatggatgcattggaacatttgctggtgacggcccacgaa
aaggtagacagtcaggactggcgtggtgtgtctgctaaaaacaacaacgacccaagtttt
tttggaaatgttattagcggcgttttcgctgtagagtctcctatctcgcgtccagcagct
gctaatgataggttaactgttctactctgtttccaagacgctgtccgaactagttacaat
gtttggaaatgtgcggaacaaagttgcaaaccttctcatgatccaaccgactctgttgta
tttgtgttgtcaccattgaaatcaagatcacggaagctactagcaaagttgtacagtttg
gaaacactggagatgctggaatgctttatcgagctatctcgtagttccggcggtgatgta
ttcaaggttcttcatgttttagacggctcgcgacccaagctaactattccataccttttc
aatgctctaatcagcagaatgaactcttcatctctagaacctgctgataaatcgacactt
acaactgacctaaccgacactgaaatcatggaattcctcatcaactacctcaaatcactg
gaaaatgataccattgaagaggtatggtatgaatgtatgggttttgtgcgtgaggtgtat
aataatcagagtctatacagaatggttattcccagcgttctccgatttaccgctaaaatg
gcggaaaaagttgacgcagttaaattcggaagtcaacgtaaagttcgcaaagacctatct
gacttgtttctcaagcttcttcattttgcattgaatactcggtctgctgttactgttgaa
gccaatattaccaacggtgagactgtttccacaggagctactggtgctagcgcaccagca
ctcagtgaaaaagatatcgatgacggctctgtggatactagtgtgccatcaacgcctcac
atgtcgagctcgacaacgtcactcgctcttcaatacaaccagggaacaagtggtagctcc
tcattgaagcaagaagacctcataaaagctctagaacaaattgtcccgtcgttacgacta
attattaatgaccaggataaaactctaacagctatcaccagcataaccaccaatttggtc
accccagcattgagacaaaagaactactcaaatgtatcaccttcgctcatgtcgttactc
aaaaccatcacccatctcccgtcgacactcaaagcatggaagggcattgtaggagacgca
ttcctagacccgcgatttctgggtatttccatgtcacaggcttctgaactgtggcagcca
gtaatctccaaatggagccagttcgataaagaacgaatcaaagactatgtttctcgtatc
agctcctacggaaccaactcaaatgtcctgttcaactggtctgatcaagaatcatccatc
cagagtcaaaaccttgacagactggcctacctcttcatatgtggcactggtgacgggttt
gctttcagtttcaaggacctgatgaccaaattcgaacttctcagtgtcggacgaaacacc
cagcatgtctacctttgtctccgtgcaataattttatcagttgacccatcccatctcgct
ccagtatggacattcctctactctcatctgtctagtacattcctggactttctcgaccag
gacaaaaatgttgatcttgaaacgctcgtggcagcctgtcgtctcctcgatacgacttta
gtcctcaatcctgaagagttccagagctatgaatggctcttcatctcagactctatggac
gccattttccgcaatgaagaccgagacccttcaggtattgttgaccgtatctcggcttcg
aaactgctacctccggcccaaactgtaagtggatggagggcatatttgcctccggcggct
ggggctccgccccagaccccatggctcctctcgcttcgctcgagtcggtgctga

DBGET integrated database retrieval system