KEGG   Sugiyamaella lignohabitans: AWJ20_4699Help
Entry
AWJ20_4699        CDS       T05270                                 

Gene name
SDH1
Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit SDH1
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
slb  Sugiyamaella lignohabitans
Pathway
slb00020  Citrate cycle (TCA cycle)
slb00190  Oxidative phosphorylation
slb01100  Metabolic pathways
slb01110  Biosynthesis of secondary metabolites
slb01130  Biosynthesis of antibiotics
slb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:slb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AWJ20_4699 (SDH1)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AWJ20_4699 (SDH1)
Enzymes [BR:slb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AWJ20_4699 (SDH1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 HI0933_like DAO
Motif
Other DBs
NCBI-GeneID: 30036858
NCBI-ProteinID: XP_018736232
UniProt: A0A167E825
LinkDB All DBs
Position
D:299330..301162
Genome map
AA seq 610 aa AA seqDB search
MKPIRAQEASKHVSSKYPVIDHEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRS
HTVAAQGGINAALGNMHPDNWKWHMYDTVKGSDWLGDQDAIHYMTKEAPQSIIELEHYGV
PFSRNDEGRIYQRAFGGQSKEFGKGGQAYRTCAVADRTGHALLHSLYGQSLRHNTNFFIE
FFAMDLLMQDGECVGVMAYNQEDGTLHRFRAHKTVLATGGYGRAYFSCTSAHTCTGDGLA
MVTRAGLPLQDLEFVQFHPTGIYGSGCLITEGSRGEGGYLLNKNGERFMERYAPTAKDLA
SRDVVSRSMTLEIREGRGVGPENDHIYLQLSHLPAEVLKERLPGISETAAIFAGVDVTKE
PIPVLPTVHYNMGGIPTKWTGEALTVDENGNDKVVPGLYACGEAACVSVHGANRLGANSL
LDLVVFGRAVAHTIRDQLTPGTPLKPVSADIGHESIANLDKVRTATGSKSTAEIRLNMQK
VMQTDVSVFRTQESLEDGVRRITEVDKSIVDLGTTDRSMIWNSDLVESLELQNLLTCAMQ
TAYSAVARKESRGAHAREDYPERDDVNWMKHTLSWQDKPGDPVKLGYRNVISTTLDEAEC
PSVPPAKRVY
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccatccgagcccaggaggccagtaagcatgtcagttcgaagtatccagtgatt
gaccacgagtacgacgccattgtggttggtgccggtggtgcaggtctgcgtgctgctttc
ggtttggccgaggctggtttcaatacagcttgtatttccaagttgtttcctactcgttcg
cacacagtagctgctcaaggtggtattaatgctgctcttggtaacatgcaccctgataac
tggaagtggcacatgtacgacacagtcaagggatccgattggttgggtgaccaagatgct
attcactatatgactaaggaggcacctcaatccattatcgagttggaacactatggtgtg
ccattctctcgtaacgatgagggccgtatctaccaacgtgcttttggtggtcaatccaag
gagttcggtaagggtggtcaagcataccgtacttgtgccgttgctgatagaaccggtcat
gctttattacattccttatatggacagtctttgcgacacaatactaatttcttcattgag
ttctttgccatggatttgctgatgcaggatggcgagtgtgtgggtgtcatggcctataac
caggaagatggtactctacatagattccgtgctcacaagaccgttttggccactggtgga
tacggaagagcatatttctcatgtacctctgctcacacatgtacaggagatggtcttgct
atggttaccagagctggtttgccattacaagatttggagtttgttcaattccatcctact
ggtatttatggatcaggatgtttgattactgaaggatctcgtggtgaaggtggttacttg
ttgaacaagaacggtgaacgtttcatggagagatatgctcctactgccaaggatttggct
tctcgtgacgttgtttctcgttccatgactttggaaatcagagagggccgtggtgttggt
cctgaaaatgaccacatctacttgcaattgtctcacttgcctgccgaggtgttgaaggag
agattgcctggtatttctgagactgctgctattttcgcaggtgtcgatgtcaccaaggaa
cctattcctgttcttcctaccgtccactataacatgggtggtattcctaccaagtggacc
ggtgaggctcttactgtggatgagaacggaaacgacaaggttgttcctggtctgtatgca
tgtggtgaagctgcctgtgtttccgttcacggagccaacagattgggtgccaactcattg
cttgatttggttgtatttggtcgtgctgttgcccacactatccgtgaccaattgactcct
ggtactcctcttaaacccgtttctgctgatattggtcatgagtctattgccaaccttgac
aaggtccgtactgctactggatccaagtccactgccgagatccgtcttaatatgcaaaag
gtcatgcaaaccgatgtgtctgtattcagaactcaagagtctcttgaagatggtgtcaga
cgtattaccgaggttgacaagtctattgttgacttgggtaccactgaccgttctatgatc
tggaacagtgaccttgtcgagtctcttgaattacagaacctgttgacctgtgccatgcaa
actgcttactctgctgttgctcgtaaggagtctcgtggtgctcatgcccgtgaagattat
cccgaacgtgacgacgtcaactggatgaagcacactctttcatggcaagacaagcccggt
gaccccgtcaagctcggctacagaaacgtcatctccaccacactcgacgaggccgagtgc
ccttcagtgcctcctgccaagcgtgtctattaa

DBGET integrated database retrieval system