KEGG   Sugiyamaella lignohabitans: AWJ20_4803Help
Entry
AWJ20_4803        CDS       T05270                                 

Gene name
SET2
Definition
(RefSeq) histone methyltransferase SET2
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
slb  Sugiyamaella lignohabitans
Pathway
slb00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:slb00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    AWJ20_4803 (SET2)
Enzymes [BR:slb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     AWJ20_4803 (SET2)
Chromosome and associated proteins [BR:slb03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     AWJ20_4803 (SET2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SET WW Med26
Motif
Other DBs
NCBI-GeneID: 30036975
NCBI-ProteinID: XP_018736329
UniProt: A0A167EAW9
LinkDB All DBs
Position
D:complement(598643..601018)
Genome map
AA seq 791 aa AA seqDB search
MSKISRPIKVIEFSDSDDDLYGDKPSKQNGSHGPAENSVSSEKVRVAAAPSKVLKKENNI
KISTSKPKVEIIDISNDDKSDIDEDDEPVSGAGRRARGNGTVTRSDLKQENTITDGDSAG
SEEPVDPFDDQIKPKSEDKKNVKVTRQLFNDLESKTAEAQSTYIQLEQCTYQGRGNIGSS
GQVEAMNCDCREHWVNGKNIACGDDSDCINRLTSIECTNDNCTCGDDCGNQRFQAKQYAN
VDVIQTELKGYGVRALEAIPQNTFIYEYIGEVIDESNFRQRMETYKLEGIRHFYFMMLQK
GEFIDATKQGSMARFCNHSCRPNCYVDKWIVGDKVRMGIFSKRDIIKGEEITFDYNVDRY
GTQAQPCYCGESNCIGILGGKTQTEAAATKLPQLIVDVLDLTRQDEKQWLSIAKKFKKDG
RDGKYATADASGASDEDLYREYSLSLPAKPVQEESVTKIMSALLQGQEQWLIEKLVNRIF
ITDDSSVHGQVMRMHGYQVFSVILAADWPNDVVPLMILEILTRWPRLTKNKISSSKIESI
VAGLAKDSTSDKVQKLASTLLQEWSSLEMAYRIPRRERGAKESTNSNSASGTPQEEGASS
SPTRPAYPRAYGSNSHDNIQDNRGEKLPRRDWGAKDNYNNRGRERDYDNRYRRNRTRSPS
PLPSGWETALAPDGRRYYFNRTTGLSSWTLPKEGSPQKDSRIIPDNEREKAELLQKEQER
LQIEQIIESANQSRQNIVLLQQQKINELQSIVDAVKTKSSHRSSHRPSSEKKKKREDDTP
ESVFTRTVSST
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaaatatcaaggcctattaaggtgatcgaattttcggactcagatgacgacctg
tatggagataagcccagcaaacaaaacggatcgcatggaccagcagagaactcggtctcg
agtgaaaaggtccgcgttgcggcagccccatcaaaggtcttgaaaaaggaaaacaatata
aaaatttcaactagcaaacccaaggtggaaatcatcgatattagtaatgacgacaagtcg
gatattgacgaagatgacgaaccagtttctggagctggcagaagggcaagaggcaacgga
actgtgactcgctctgatttgaaacaagaaaacacaattactgatggcgacagtgctggt
tcagaagagcctgttgatccatttgacgaccagattaaaccgaaatctgaagacaaaaag
aatgtaaaagttactcgacaactcttcaacgacctagagtctaagactgcagaggctcaa
tcaacatatatccagctcgaacagtgcacataccaaggaagaggcaatattggtagctca
ggtcaagtggaagctatgaactgtgactgccgggagcactgggttaatggaaaaaatatt
gcatgtggtgatgattctgattgtattaatagactcacgtctattgagtgtactaacgat
aactgtacatgcggagacgactgtggcaatcagaggtttcaagctaaacaatatgctaat
gtggatgttattcaaactgagctcaaaggatatggtgtacgggcgttggaggcgattcct
caaaatacttttatctacgaatatataggtgaggtcattgacgaaagtaatttccgtcaa
agaatggaaacctataaattggaaggaatccgacacttttactttatgatgcttcagaaa
ggcgagtttatagatgccacgaaacaaggaagtatggcgcgattctgtaaccattcctgt
cgtcctaactgctatgttgacaaatggattgttggcgacaaagttagaatgggcattttc
agcaaacgggatattatcaaaggcgaggagattacctttgattataatgtagaccgatat
ggtactcaagcacaaccttgttattgtggagagtcgaattgcataggtatcttaggtgga
aagactcagacggaggcagcagctaccaaactaccgcaactaatagtcgacgttctcgat
ctcacgcgacaagatgagaagcagtggctttctattgccaaaaaattcaaaaaagatggc
cgagatggcaaatatgccactgctgatgctagtggggcttcagatgaggatctgtatcga
gagtattcactgtcgcttcctgccaaacctgttcaggaagagtcggtaaccaaaatcatg
agtgcgctgcttcaaggccaggagcagtggttaattgaaaaactggtcaaccgtattttt
attacggatgatagcagtgtgcatggccaagtgatgagaatgcatggataccaagtgttc
agtgtaatattagcagcagactggcccaatgatgtagtgccactaatgattctggagatt
ctgactcgatggccacgactgaccaaaaacaagatttccagttcgaaaatcgagtctatc
gtagctggactggctaaagatagtacatcagacaaagtgcagaaactggcatccacttta
ctccaagaatggagcagtttagaaatggcatatcggattccccgacgagaaagaggtgct
aaagaaagcactaattcgaattcagccagtggtactcctcaagaagagggagcgtcatcg
tcaccaaccagaccagcatatcctcgtgcttatggtagtaatagccacgataatattcaa
gacaaccgtggtgaaaagctaccgagacgagactggggtgctaaagataactataataat
agaggccgggagcgggattatgataatcggtaccgtcgcaataggaccagatcaccatca
ccgctaccttcaggctgggaaacggctttagcaccagacgggcgtcgatattatttcaac
cgcaccacaggactcagttcctggacgctaccgaaagaagggtctccacaaaaagactcg
cgcattattcccgataacgagagagaaaaggccgaactgctgcagaaagagcaagaacgg
cttcaaatcgaacagatcatcgaatcagcaaaccaaagtcgccaaaatattgtgcttctg
caacagcagaaaatcaacgagctgcagtccattgtcgacgctgtgaaaaccaaatcatcg
catcggtccagccatcggccaagcagtgaaaagaaaaagaagcgtgaggacgatactcca
gaatccgtcttcaccagaactgtaagtagcacctag

DBGET integrated database retrieval system