KEGG   Sugiyamaella lignohabitans: AWJ20_491Help
Entry
AWJ20_491         CDS       T05270                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
slb  Sugiyamaella lignohabitans
Pathway
slb00480  Glutathione metabolism
slb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AWJ20_491
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:slb02000]
    AWJ20_491
Enzymes [BR:slb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AWJ20_491
Transporters [BR:slb02000]
 Other Transporters
  Pores ion channels [TC:1]
   AWJ20_491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2
Motif
Other DBs
NCBI-GeneID: 30037093
NCBI-ProteinID: XP_018734719
UniProt: A0A167CY13
LinkDB All DBs
Position
A:complement(join(1554174..1554831,1555270..1555382))
Genome map
AA seq 256 aa AA seqDB search
MGTASGGWGSAPDPAAPLATLESVPWGYSDSCEAGATGCPWANRTWLALEIAGAKYELKE
IDLQNKPDWFLKISTKVPAVTVNGEILVESAITTRYVAELFPEAGLLSSDPLINAKSQLW
ADRFIETLPAATIYPIFRGVERTDAEIESSFFEALDKAIPYLQPNKKDGDGPFAAGQSRV
QLGDVLVAPFVGRINLLIEKGIIPSSIKTKLTTDPKYASYVEYVKAIHDLPAFKKIFNVD
AIYQSFAKRIQDAKKQ
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgggcactgcctccggcggctggggctccgccccagaccccgctgctcctctcgctacg
ctcgagtcggttccgtggggatacagtgactcctgcgaagcaggagcaacgggttgccct
tgggctaatcgtacgtggcttgcgcttgaaattgctggtgccaagtatgaattgaaagag
attgatctccaaaacaaacctgattggttccttaagatctccacaaaggttcctgctgtc
actgtcaatggcgagattttagtcgagtcggccatcaccactcgttatgttgccgaattg
ttcccagaggctggtttgctttctagtgatcctttaattaatgctaagagtcagttgtgg
gccgatagattcattgagacacttcctgctgctactatctaccctatttttagaggtgta
gaacgtacggacgctgagattgagagctcgttcttcgaagctttggacaaggccattcct
tacttgcaacctaacaagaaagatggtgatggaccttttgctgctggtcagtcgagagtt
caacttggcgatgttttggttgctccatttgttggcagaattaacttattgatcgagaaa
ggtattatccccagctctatcaagaccaagctcaccaccgatcctaagtacgcttcttat
gttgaatatgtcaaggccattcatgatcttcctgctttcaagaagattttcaatgttgat
gccatttaccaatcgtttgcaaagaggattcaagatgccaagaaacagtaa

DBGET integrated database retrieval system