KEGG   Sugiyamaella lignohabitans: AWJ20_4946Help
Entry
AWJ20_4946        CDS       T05270                                 

Gene name
SOR1
Definition
(RefSeq) L-iditol 2-dehydrogenase SOR1
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
slb  Sugiyamaella lignohabitans
Pathway
slb00040  Pentose and glucuronate interconversions
slb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AWJ20_4946 (SOR1)
Enzymes [BR:slb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     AWJ20_4946 (SOR1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Pyr_redox_2 AlaDh_PNT_C Sacchrp_dh_NADP UDPG_MGDP_dh_N 2-Hacid_dh_C 3HCDH_N Methyltransf_25 Shikimate_DH
Motif
Other DBs
NCBI-GeneID: 30037133
NCBI-ProteinID: XP_018736469
UniProt: A0A167EEZ6
LinkDB All DBs
Position
D:complement(1026316..1027365)
Genome map
AA seq 349 aa AA seqDB search
MSNPSFVLQKVNEVSFEDRPVPEIKDPHYVKIAVKKTGICGSDVHYYTHGAIGDFVVKAP
MVLGHESAGVIVEVGSEVKNLKVGDRVAMEPGVPSRYSDEYKSGRYNLCPCMAFAATPPY
DGTLAKYYLLPEDYCVKLPDHVSLDEGALVEPLAVGVHSSKLADVRPGSKVAVFGAGPVG
LLITAVASAFGASSVTVIDIVQNRLDLAKELGATHTVLASIKDTSDETAKKVVAATGAQP
DIVLDASGAESSINAAISAIKPGGTYVQVGMGKPNVNFPIANVIGKELTIKGSFRYGYGD
YPLAVELISSGKVNVKKLISHTVKFEEAKEAFELVMSGKAVKVIIDGPQ
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtctaacccatcatttgttcttcaaaaagtcaacgaggtttcctttgaggaccgtcct
gtccctgagatcaaggaccctcactatgtcaagattgccgtcaagaagactggtatctgt
ggttcggatgtccactactacactcacggtgccattggtgacttcgttgtcaaggctcct
atggttttgggccacgaatctgctggtgttattgtcgaggttggttctgaggttaagaac
ttaaaggttggcgaccgtgttgctatggaacctggtgttccttccagatactctgatgaa
tacaagtctggtcgttataacctatgtccttgtatggcatttgctgccactcctccttat
gacggtactttggccaagtactaccttctccctgaagactactgtgtcaagttgccagat
cacgtttctcttgacgaaggtgctttggtcgagcctttggctgttggtgttcactccagt
aaattggctgacgtgcgtcctggttctaaggtcgctgttttcggtgctggtcctgttggt
cttttgatcactgctgttgcctctgctttcggtgcttcttccgtcactgttattgacatt
gttcaaaacagactcgatcttgccaaggaattgggcgctactcacaccgtcttggcttct
atcaaggacacctctgacgagactgccaagaaggttgttgctgccactggtgctcaaccc
gacattgttctcgacgcttctggtgccgagtcatctatcaatgcagccatctccgctatc
aagcccggtggtacttacgttcaagtcggtatgggcaagcccaacgtcaacttccccatt
gccaacgtcattggcaaggaattgaccatcaagggctctttccgttacggttacggcgac
taccccttggctgtcgagctcatctcgtccggcaaggtcaacgtcaagaagctcatctcc
cacactgtcaagttcgaggaggccaaggaggccttcgagctcgttatgagcggcaaggcc
gtcaaggtcatcatcgacggtccccagtaa

DBGET integrated database retrieval system