KEGG   Sugiyamaella lignohabitans: AWJ20_4949Help
Entry
AWJ20_4949        CDS       T05270                                 

Gene name
URH1
Definition
(RefSeq) trifunctional uridine nucleosidase/nicotinamide riboside hydrolase/nicotinic acid riboside hydrolase
  KO
K01240  uridine nucleosidase [EC:3.2.2.3]
Organism
slb  Sugiyamaella lignohabitans
Pathway
slb00240  Pyrimidine metabolism
slb00760  Nicotinate and nicotinamide metabolism
slb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    AWJ20_4949 (URH1)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    AWJ20_4949 (URH1)
Enzymes [BR:slb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.3  uridine nucleosidase
     AWJ20_4949 (URH1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IU_nuc_hydro SRF-TF
Motif
Other DBs
NCBI-GeneID: 30037136
NCBI-ProteinID: XP_018736472
UniProt: A0A167EF28
LinkDB All DBs
Position
D:1037460..1038506
Genome map
AA seq 348 aa AA seqDB search
MSLILPKIPLWIDCDPGHDDAIGLLLGSGLDQYHLVGVSTVHGNASLGNTTSNAISILTA
FKRLDVNVYPGAEKPLVRKLNVADSIHGRSGLDGTAFLPMPSFDAQPDHTAVAAMAKAIE
TYPGTLAIAALGPLTNIALLAMNYPDLLPSLRLLSIMGGGLGLGNWTKFAEFNIWCDAHA
AQIVFSDTTLIPKTLLVPLNLTHQAIATDEILEQIQKSRQLDRRSVLRQMLYELMIYFAG
TYKKKFGFKNGPPVHDAVAVAAILPFYSDNSTERSEHSNDPPAADLDLRFARYQVHVVEE
GPQEGMLVFEPDSDNGIMIAQEMNFTEFWRLVLDAVDNVESSTSLLVS
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgagtttaattctgcccaagattccactatggatcgactgtgacccgggtcacgatgac
gccattggcctgttactaggctcgggactagatcagtatcacctggtaggagtatcgaca
gtccatggaaatgcatcgttaggaaataccacatccaacgccatttccattctcactgca
ttcaaaagactcgatgttaacgtatatcccggagcagagaaaccgctagttcgcaaattg
aatgtggcagactcgattcatggtagatccggtttggatggcactgcatttctgcccatg
ccatcattcgacgcccaacccgatcatacggccgtagcagctatggccaaagccattgaa
acatatcctggaacactagcaattgcagctcttggaccactaacaaacatagctttatta
gccatgaactacccagacctgttaccgagtttacggctgttatcaataatgggaggaggt
cttggacttggcaattggaccaagttcgccgagtttaacatctggtgtgacgcccatgct
gcccagatcgtgttctcggacaccactttaattcccaaaaccctactggtgccactgaat
ctgacccaccaggcgatagccactgatgaaatactagaacagatacagaagagccggcag
ctggaccgacgctcggtgctgcgacagatgctctatgagctcatgatatacttcgcagga
acctataaaaagaagtttggattcaaaaacgggccacccgtgcacgacgcagtagcagta
gcggccattctgccattctacagcgacaactccaccgaacgcagcgagcactccaacgac
ccgccagcagcagatctcgacctgcgatttgcccgataccaagtccacgtcgtcgaagaa
gggccccaagagggtatgctcgttttcgagcccgactcggacaacggcatcatgatcgcc
caggaaatgaacttcaccgagttctggcgacttgtgctcgacgccgtcgacaatgtcgag
agctcgacgtctctcctcgtctcgtaa

DBGET integrated database retrieval system