KEGG   Sugiyamaella lignohabitans: AWJ20_938Help
Entry
AWJ20_938         CDS       T05270                                 

Gene name
IDP2
Definition
(RefSeq) isocitrate dehydrogenase (NADP(+)) IDP2
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
slb  Sugiyamaella lignohabitans
Pathway
slb00020  Citrate cycle (TCA cycle)
slb00480  Glutathione metabolism
slb01100  Metabolic pathways
slb01110  Biosynthesis of secondary metabolites
slb01130  Biosynthesis of antibiotics
slb01200  Carbon metabolism
slb01210  2-Oxocarboxylic acid metabolism
slb01230  Biosynthesis of amino acids
slb04146  Peroxisome
Module
slb_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:slb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AWJ20_938 (IDP2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AWJ20_938 (IDP2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AWJ20_938 (IDP2)
Enzymes [BR:slb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AWJ20_938 (IDP2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 30038025
NCBI-ProteinID: XP_018735151
UniProt: A0A167DAF2
LinkDB All DBs
Position
A:2988031..2989278
Genome map
AA seq 415 aa AA seqDB search
MTVATTATKIKVANPIVELDGDEMTRVIWKSIREKLILPYLDVDLKYYDLGIEYRDETND
QVTIDAANAILKYQVGVKCATITPDEARVKEFHLKKMWLSPNGTIRNILGGTVFREPIVI
PRIPRLVSGWEKPIIIGRHAHGDQYKAQDAVIKEAGTLELVFTPKNGGEAQKIKVYEYKE
DGGVALAMYNTDESIRGFAHASFKLALEKELPLYMSTKNTILKKYDGRFKDIFNELYETT
YKKEFEAKKIWYEHRLIDDMVAQMIKSSGGYIMALKNYDGDVQSDIVAQGFGSLGLMTSV
LITPDGKTFESEAAHGTVTRHYRQYQQGKETSTNSIASIFAWTRGIIQRGKLDNTPDVVK
FGEALEKATVDTVQVDGIMTKDLALACGKTDRSSYVLTEEFIDAVSSRFKKTFSS
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgacagttgctactacagccaccaaaatcaaagttgccaatcccattgtcgagctcgat
ggtgatgagatgaccagagtcatctggaagtctattcgtgaaaagctcattcttccatac
cttgatgtcgatctcaagtactacgatttgggtattgagtaccgtgatgagaccaacgac
caagtcactattgatgctgccaatgccattttgaagtaccaagttggtgtcaagtgtgct
accatcactcctgacgaggcccgtgtcaaggaattccacctcaagaagatgtggctctct
cccaatggtaccatccgtaacattcttggtggtactgttttccgtgagcccattgtcatt
cctagaatccctcgtttggttagtggctgggaaaagccaattatcattggtcgtcatgct
catggtgatcaatataaggctcaagatgctgttatcaaggaggctggtactcttgaatta
gtctttacccccaagaatggcggtgaggcccaaaagatcaaggtctatgaatacaaggaa
gatggtggtgttgctcttgctatgtacaacactgacgagtccattcgtggctttgctcat
gcttcttttaaattggctcttgagaaggagttgcctctttacatgtctactaagaacact
attcttaaaaagtacgatggtcgtttcaaggatatcttcaacgagctttacgagactact
tacaagaaggagttcgaggccaagaagatctggtacgagcaccgtttgatcgatgatatg
gtcgcccaaatgatcaagtcgagtggtggttatatcatggctctcaagaactatgacggt
gatgttcaatctgacattgttgctcaaggtttcggttctttgggtcttatgacttctgtt
cttattactcctgatggcaagactttcgagtccgaggctgctcacggaactgtcacccgt
cattacagacaatatcagcaaggaaaggagacctctaccaactccattgcttctatcttt
gcttggactcgtggtatcattcaacgtggtaaactcgacaatactcctgatgttgtcaag
ttcggtgaggccctcgagaaggccactgtcgacactgtccaagttgacggcatcatgacc
aaggatcttgctctcgcctgtggcaagactgacagatccagctatgttctcactgaggag
ttcattgacgccgtttcctcgcgtttcaagaagaccttctcctcttaa

DBGET integrated database retrieval system