KEGG   Streptomyces lydicus 103: SL103_01095Help
Entry
SL103_01095       CDS       T04699                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
slc  Streptomyces lydicus 103
Pathway
slc00380  Tryptophan metabolism
slc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slc00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    SL103_01095
Enzymes [BR:slc01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     SL103_01095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AOP50905
UniProt: A0A1D7VVV0
LinkDB All DBs
Position
248837..250054
Genome map
AA seq 405 aa AA seqDB search
MDAADPLAALRDRFVLDTVTDPATGLPDVYLDGNSLGVLPRTVPDRIADVLHREWGELRI
RSWTESGWWTAPERVGDKIAPLIGAGPGRVVVGDSTSVNIFKAVVGGVRMAGKGCTEILV
DATTFPTDGYIARSAARMTGLAVRPVEPARIADEVTERTALALVNHVDYRTGALNDLPGI
THALHSAGALAVWDLCHSAGALPVGLDAHHVDLAVGCTYKYLNGGPGSPAFLYVRESLQE
RFESPLPGWNSHAEPFAMDPSYAPADGVLRGRVGTPDILSLLALEAALEVWDGVAIEDVR
TKSLALTDFFLECVAGYVPAGRARAVTPQDHRRRGSQVSLRCSGAGEVMDELIRRGVVGD
FRHPDVLRFGFTPLYTSFADAERAAWVLGEVLGALPEVGPAVAGG
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
ctggacgccgccgatccgctcgccgcgctccgtgaccgcttcgtcctcgacacggtgacc
gacccggcgaccggcctgccggacgtctacctcgacggcaactccctgggcgtgctgccc
cgcacggtgcccgaccggatcgccgacgtcctccaccgcgagtggggcgagctgcgcatc
cgctcctggaccgaatccggctggtggaccgcgcccgagcgggtcggcgacaagatcgcg
ccgctgatcggcgcgggcccgggccgggtggtggtcggcgactcgaccagcgtgaacatc
ttcaaggccgtggtcggcggcgtccgcatggccgggaagggctgcacggagatcctggtc
gacgccacgaccttcccgaccgacggctacatcgcccggtccgcggcccggatgaccggt
ctcgcggtgcggccggtggagcccgcgcggatagccgacgaggtcaccgagcgcaccgcg
ctggcgctggtcaaccacgtcgactaccgcaccggcgcgctcaacgacctgcccggcatc
acccacgccctgcactccgcgggggcgctcgcggtctgggacctgtgccacagcgcgggc
gcgctgccggtcggcctggacgcccaccacgtcgacctggccgtcggctgcacgtacaag
tacctcaacggcgggccgggctcgccggccttcctgtacgtccgcgagagcctccaggag
cggttcgagtcgccgctgcccggctggaactcgcacgccgagccgttcgccatggacccc
tcgtacgcccccgcggacggcgtcctgcgcggccgcgtcggcacccccgacatcctgtcg
ctgctcgcgctggaggccgcgctggaggtctgggacggggtcgccatcgaggacgtacgg
accaagagcctggccctgacggacttcttcctggagtgcgtggccgggtacgtaccggcc
ggccgggcccgtgcggtcacgccgcaggaccaccggcggcgcggcagccaggtgtcgctg
cgctgctccggggcgggcgaggtgatggacgagctgatccggcgcggggtggtcggcgac
ttccgccaccccgacgtgctgcggttcggcttcaccccgctctacacctccttcgcggac
gcggagcgggcggcgtgggtgctcggcgaggtgctgggggcgctgcccgaggtgggaccg
gcggtggccggcgggtga

DBGET integrated database retrieval system