KEGG   Streptomyces lydicus 103: SL103_07570Help
Entry
SL103_07570       CDS       T04699                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
slc  Streptomyces lydicus 103
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AOP46113
UniProt: A0A1D7VH74
LinkDB All DBs
Position
1761151..1762602
Genome map
AA seq 483 aa AA seqDB search
MSDLVEHGKLYIGGELVDPAGRDTIEVVSPHTEQVIGRVPHASRADVDRAVAAARASFAS
GVWANAPLAERIAVVTRIKDALAARSEEIARVISSENGTPYTSGVMVQSLASVLAWDAAL
TVARDFPFEERRAGVLGPLLVRREPVGVVAAVVPWNVPQFTAAAKLAPALLAGCSVVLKV
SPETPLDAYLLAEIVTEAGLPRGVLSILPADREVSEYLVGHPGVDKVSFTGSVAAGKRVM
EVAARHLTRVTLELGGKSAAVILPDADLDAAVAGIVPFAWMINGQACVAQTRILVPRGRY
DEIAERFTAAAAALTVGDPLDPATEVGPLVARRQQQRSLDYIALGQKEGAKILTGGGRPK
DRATGWYVEPTLFGEVANSMRIAREEIFGPVICLLPYEDEAEAVEIANDSDYGLSGSVWT
ADVDHGIDVARQVRTGTYSVNTFSLDMLGPFGGYKNSGIGREFGPEGFGEYLEHKMIHLP
AGA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacctcgtcgagcacggcaagctctacataggcggtgagctggtcgatccggcc
ggccgggacaccatcgaggtcgtctcgccgcacaccgaacaggtcatcggccgcgtcccg
cacgcctcgcgggccgacgtcgaccgcgcggtggccgcggcccgcgcgtccttcgcgtcc
ggggtgtgggcgaacgccccgttggcggagcggatcgcggtggtgacccgcatcaaggac
gccctcgcggcgcgcagcgaggagatcgccagggtcatcagctccgagaacggcaccccg
tacacctcgggcgtcatggtgcagtcgctggcctcggtgctggcctgggacgcggcgctg
acggtggcgcgtgacttccccttcgaggagcggcgggccggggtgctgggtccgctcctc
gtgcggcgggaaccggtcggcgtggtcgcggccgtggtgccgtggaacgtcccgcagttc
accgccgccgccaagctcgcgccggccctgctggccggctgctcggtggtgctgaaggtg
tcgccggagaccccgctcgacgcctacctcctggcggagatcgtgacggaggccgggctg
ccgcggggcgtgctgtcgatcctgccggcggaccgcgaggtgagcgagtacctggtcggg
cacccgggcgtggacaaggtctcgttcaccggctcggtggcggcgggcaagcgggtcatg
gaggtcgcggcccgccacctcacccgggtcacgctggaactcggcggcaagtccgccgcg
gtgatcctgccggacgcggacctcgacgcggcggtggccggcatcgtgccgttcgcctgg
atgatcaacggtcaggcgtgcgtggcgcagacccggatcctcgtaccgcgcggacgctac
gacgagatcgccgaacggttcaccgcggcggccgccgcactcaccgtcggcgacccgctg
gatccggccaccgaggtcgggccgctcgtcgcccgccgccagcagcagcgttcgctcgac
tacatcgccctcggccagaaggaaggcgccaagatcctcaccggcggcggccggccgaag
gaccgggccacgggctggtacgtcgaaccgaccctcttcggcgaggtggccaactccatg
cggatcgcccgcgaggagatcttcggccccgtcatctgcctgctgccgtacgaggacgag
gcggaggcggtggagatcgccaacgactccgactacgggctctccggttcggtctggacg
gccgacgtcgaccacggcatcgacgtcgcacggcaggtgcgcaccggtacgtactcggtc
aacaccttcagcctcgacatgctcggcccgttcggcggctacaagaactccggcatcggg
cgggagttcggcccggagggcttcggcgagtacctggagcacaagatgatccatctgccg
gcgggggcgtga

DBGET integrated database retrieval system