KEGG   Streptomyces lydicus 103: SL103_10820Help
Entry
SL103_10820       CDS       T04699                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
slc  Streptomyces lydicus 103
Pathway
slc00010  Glycolysis / Gluconeogenesis
slc00053  Ascorbate and aldarate metabolism
slc00071  Fatty acid degradation
slc00280  Valine, leucine and isoleucine degradation
slc00310  Lysine degradation
slc00330  Arginine and proline metabolism
slc00340  Histidine metabolism
slc00380  Tryptophan metabolism
slc00410  beta-Alanine metabolism
slc00561  Glycerolipid metabolism
slc00620  Pyruvate metabolism
slc00625  Chloroalkane and chloroalkene degradation
slc00903  Limonene and pinene degradation
slc01100  Metabolic pathways
slc01110  Biosynthesis of secondary metabolites
slc01120  Microbial metabolism in diverse environments
slc01130  Biosynthesis of antibiotics
Module
slc_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:slc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SL103_10820
   00053 Ascorbate and aldarate metabolism
    SL103_10820
   00620 Pyruvate metabolism
    SL103_10820
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SL103_10820
   00561 Glycerolipid metabolism
    SL103_10820
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SL103_10820
   00310 Lysine degradation
    SL103_10820
   00330 Arginine and proline metabolism
    SL103_10820
   00340 Histidine metabolism
    SL103_10820
   00380 Tryptophan metabolism
    SL103_10820
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SL103_10820
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SL103_10820
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SL103_10820
Enzymes [BR:slc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SL103_10820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AOP46665
UniProt: A0A1D7VIS5
LinkDB All DBs
Position
2519523..2520917
Genome map
AA seq 464 aa AA seqDB search
MKQHDAMYIGGSWRPAAGDGTIEVVDPADGRVIATVPAGSAADVDAAVRAARAALPGWAA
TPPAERADRLAALHEQLVGRAEEIAETVTAELGSPLAFSRAVHAGVPAAVCGSYAELART
FSFEERIGNSTVLLEPVGVVGAITPWNYPLHQVVAKVAPALAAGCTVVLKPAEDTPLVAQ
LFAECVDAAGIPAGVFNLVTGLGPVAGQALAEHDGIDLVSFTGSTAVGRRIGAAAGAAVK
QVALELGGKSANVVLPSADLAKAVAVGVANVMANSGQTCSAWTRMLVHEDRYDEAVALAA
AAVAKYVPGERVGPLVSARQRDRVRGYIERGLAEGARLVAGGPEAPCAQGYFVSPTVFAD
VTPDMTLAQEEIFGPVLSLMKYADEDDAVRIANGTVYGLAGAVWAADEAEAVAFARRLDT
GQVDINGGRFNPLAPFGGYKQSGVGRELGPHGLTEYLQTKSLQF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcagcacgacgcgatgtacatcggcggaagctggcggcccgccgcgggcgacggc
acgatcgaggtcgtggacccggccgacggacgggtcatcgcgaccgtgccggccggttcc
gccgcggacgtggacgccgcggtgcgcgccgcccgcgccgccctccccggctgggcggcc
accccgcccgcggagcgcgccgaccggctggccgcgctgcacgagcagctggtggggcgc
gccgaggagatcgcggagacggtgaccgccgagctgggctcaccgctcgccttcagcagg
gcggtgcacgccggggtgccggccgcggtctgcggctcgtacgccgaactggcccggacc
ttctccttcgaggaacggatcggcaactccaccgtgctgctggagccggtcggcgtggtc
ggcgcgatcaccccctggaactacccgctgcaccaggtcgtcgccaaggtcgccccggcg
ctggcggccggctgcacggtggtgctcaaaccggccgaggacaccccgttggtggcccag
ctcttcgccgagtgcgtcgacgcggccgggatacccgccggggtgttcaacctcgtcacc
ggcctcggcccggtcgccggccaggcgctcgccgagcacgacgggatcgatctggtctcc
ttcaccggctccaccgccgtcggccggcggatcggtgccgccgcgggcgccgcggtcaag
caggtggcgctggaactgggcggaaaatccgccaacgtcgtcctgccgtccgccgacctc
gccaaggcggtcgccgtcggcgtcgccaacgtcatggccaactccggccagacctgcagc
gcctggacccggatgctggtgcacgaggaccggtacgacgaggccgtcgcgctggccgcc
gccgcggtcgccaagtacgtgccgggcgagcgggtcggcccgctggtgagtgcccggcag
cgggaccgggtgcgcggctacatcgagcgggggctcgccgagggcgcgcggctggtcgcg
ggcggccccgaagccccgtgcgcgcagggctacttcgtcagccccaccgtcttcgccgac
gtcacccccgacatgaccctcgcgcaggaggagatcttcggcccggtgctgtcgctgatg
aagtacgcggacgaggacgacgcggtccgcatcgccaacggcaccgtctacggcctggcc
ggcgcggtctgggcggccgacgaggccgaggcggtcgccttcgcccggcgcctggacacc
ggacaggtcgacatcaacggcggccgcttcaacccccttgccccgttcggcggttacaag
cagtccggcgtcggccgggagctgggcccgcacgggctgaccgagtacctgcagaccaag
tcgctccagttctga

DBGET integrated database retrieval system