KEGG   Streptomyces lydicus 103: SL103_27650Help
Entry
SL103_27650       CDS       T04699                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
slc  Streptomyces lydicus 103
Pathway
slc00250  Alanine, aspartate and glutamate metabolism
slc00280  Valine, leucine and isoleucine degradation
slc00310  Lysine degradation
slc00410  beta-Alanine metabolism
slc00640  Propanoate metabolism
slc00650  Butanoate metabolism
slc01100  Metabolic pathways
slc01120  Microbial metabolism in diverse environments
Module
slc_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:slc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SL103_27650
   00650 Butanoate metabolism
    SL103_27650
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SL103_27650
   00280 Valine, leucine and isoleucine degradation
    SL103_27650
   00310 Lysine degradation
    SL103_27650
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SL103_27650
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:slc01007]
    SL103_27650
Enzymes [BR:slc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SL103_27650
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     SL103_27650
    2.6.1.48  5-aminovalerate transaminase
     SL103_27650
Amino acid related enzymes [BR:slc01007]
 Aminotransferase (transaminase)
  Class III
   SL103_27650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AOP49517
UniProt: A0A1D7VRZ9
LinkDB All DBs
Position
6401092..6402441
Genome map
AA seq 449 aa AA seqDB search
MTELSGGPGLPQERRVVTAIPGPKSQELWARKQATVASGVGAVLPVFVKRAGGGVLEDVD
GNSLIDFGSGIAVTSVGNSAEAVVRRASAQLAEFTHTCVMVTPYEPYIEVCEQLAELTPG
DHAKKSALFNSGAEAVENAVKIARAYTKRQAVVVFDHGYHGRTNLTMALTAKNMPYKHGF
GPFAPEVYRVPVAYPYRWLTGPENCAQEAADQAISQITKQIGAENVAAIIIEPVLGEGGF
IEPAKGFLPAIANFAKENGIVFVADEIQSGFCRTGQWFACEDEGVVPDLITTAKGIAGGL
PLAAVTGRAEIMDAAHAGGLGGTYGGNPVACAAALGSIETMREQDLNGKALRIGEVMKAR
LNAMAEKYDIIGEVRGRGAMIAIELVKSGSKDPNPEATGALAKACHQEGLLVLTTGTYGN
VLRFLPPLVIGEDLLNEGLDILEAAFTKI
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaactgtccggaggccccggcctcccccaggagcgtcgcgtcgtcaccgcgatc
cccggcccgaagtcgcaggagctgtgggcccgtaagcaggccacggtggccagtggcgtc
ggtgccgtactgcccgtcttcgtcaagcgcgcgggcggtggcgtcctggaggacgtggac
ggcaactccctgatcgacttcggctcgggcatcgcggtgacctcggtcggcaacagcgcg
gaggcggtcgtccgccgggccagcgcgcagctcgccgagttcacccacacctgtgtgatg
gtcacgccgtacgagccgtacatcgaggtctgtgagcagctcgccgagctgacgccgggc
gaccacgcgaagaagtcggcgctgttcaactcgggcgcggaggccgtcgagaacgccgtc
aagatcgcgcgggcgtacaccaagcggcaggccgtggtcgtcttcgaccacgggtaccac
ggccggacgaacctgacgatggcgctcaccgccaagaacatgccgtacaagcacggcttc
ggcccgttcgcgcccgaggtctaccgcgtgccggtggcctacccctaccgctggctgacc
ggcccggagaactgcgcgcaggaggccgccgaccaggccatctcgcagatcaccaagcag
atcggcgcggagaacgtcgcggcgatcatcatcgagccggtgctcggtgagggcggcttc
atcgagccggccaagggcttcctcccggcgatcgcgaacttcgccaaggagaacggcatc
gtcttcgtcgcggacgagatccagtccggcttctgccgtacgggtcagtggttcgcgtgt
gaggacgagggcgtcgtgccggacctgatcacgacggcgaagggcatcgccggcggtctg
ccgctggccgccgtgaccggtcgcgcggagatcatggacgccgcgcacgcgggcggcctg
ggcggcacctacggcggtaacccggtggcctgcgccgccgcgctcggctcgatcgagacc
atgcgcgagcaggacctcaacggcaaggcgctgcggatcggcgaggtcatgaaggcccgc
ctcaacgcgatggccgagaagtacgacatcatcggcgaggtccgcggccggggcgcgatg
atcgcgatcgagctggtgaagtccggttccaaggaccccaacccggaggccaccggcgcc
ctcgcgaaggcgtgccaccaggagggcctgctggtcctgacgaccggtacgtacggcaac
gtgctgcgcttcctgccgccgctggtcatcggtgaggacctgctcaacgagggcctggac
atcctcgaggcggcgttcaccaagatctga

DBGET integrated database retrieval system