KEGG   Streptomyces lydicus 103: SL103_29435Help
Entry
SL103_29435       CDS       T04699                                 

Definition
(GenBank) superoxide dismutase, Ni
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
slc  Streptomyces lydicus 103
Brite
KEGG Orthology (KO) [BR:slc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SL103_29435
Enzymes [BR:slc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SL103_29435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni BtrH_N DUF2254
Motif
Other DBs
NCBI-ProteinID: AOP49820
UniProt: A0A1D7VSU2
LinkDB All DBs
Position
6810104..6810499
Genome map
AA seq 131 aa AA seqDB search
MLSRLFAPKVKVSAHCDLPCGVYDPAQARIEAESVKAVQEKYQANEDADFRTRAVLIKEQ
RAELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDTLKALSAAKGSNDPATGQKALDYIAQ
IDKIFWETKKA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgctttcgcgcctgttcgcccccaaggtgaaggtcagcgcccactgcgacctgccctgc
ggcgtgtacgacccggcccaggcccgcatcgaggccgagtcggtcaaggccgtccaggag
aagtaccaggccaacgaggacgcggacttccgcactcgcgccgtcctgatcaaggagcag
cgcgccgagctggccaagcaccacgtctccgtgctgtggagcgactacttcaagcccccg
cacttcgagaagtacccggagctgcaccagctggtcaacgacaccctcaaggccctcagc
gccgccaagggttcgaacgacccggccaccggccagaaggccctggactacatcgcccag
atcgacaagatcttctgggagaccaagaaggcttga

DBGET integrated database retrieval system