KEGG   Streptomyces lydicus 103: SL103_31375Help
Entry
SL103_31375       CDS       T04699                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
slc  Streptomyces lydicus 103
Pathway
slc00020  Citrate cycle (TCA cycle)
slc00190  Oxidative phosphorylation
slc00650  Butanoate metabolism
slc01100  Metabolic pathways
slc01110  Biosynthesis of secondary metabolites
slc01120  Microbial metabolism in diverse environments
slc01130  Biosynthesis of antibiotics
slc01200  Carbon metabolism
Module
slc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
slc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
slc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:slc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SL103_31375
   00650 Butanoate metabolism
    SL103_31375
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SL103_31375
Enzymes [BR:slc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SL103_31375
    1.3.5.4  fumarate reductase (quinol)
     SL103_31375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 HI0933_like DAO Pyr_redox_2 Sirohm_synth_C GCK
Motif
Other DBs
NCBI-ProteinID: AOP50161
UniProt: A0A1D7VTV0
LinkDB All DBs
Position
7239069..7240823
Genome map
AA seq 584 aa AA seqDB search
MKIHKYDTVIVGAGGAGMRAAIESTKRSRTAVLTKLYPTRSHTGAAQGGMAAALANVEDD
NWEWHTFDTIKGGDYLVDQDAAEILAKEAIDSVLDLEKMGLPFNRTPEGKIDQRRFGGHS
RNHGEAPVRRSCYASDRTGHMILQTLYQNCVKEGVEFFNEFYVLDLLLQDVDGVKKSAGV
VAYELATGEIHVFQAKSIVFASGGTGKFFKVTSNAHTLTGDGQAAAYRRGLPLEDMEFFQ
FHPTGIWRMGILLTEGARGEGGILRNKDGERFMEKYAPVMKDLASRDVVSRSIYTEIREG
RGCGPDGDHVYLDLTHLPPEQLDAKLPDITEFARTYLGIEPYTDPIPIQPTAHYAMGGIP
TNVEGEVLADNTTVVPGLYAAGEVACVSVHGANRLGTNSLLDINVFGRRAGIAAAEYSSS
ADFVELPEDPAQQVVEQVERLRNSSGTERVTEIRKELQECMDANVMVFRTEQTIKTAVEK
IGELRERYRNVAIQDKGKRFNTDLLEAIELGNLLDLAEVMAVSALARKESRGGHYREDYP
NRDDVNFMRHTMAYREVGADGTESIRLDYKPVVQTRYQPMERKY
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgaagatccacaagtacgacaccgtcatcgtcggcgccggcggcgcgggcatgcgcgcg
gccatcgagtcgaccaagcgcagccgcaccgcggtcctgacgaagctctacccgacccgc
tcccacaccggcgccgcccagggcggtatggccgccgccctcgcgaacgtcgaggacgac
aactgggagtggcacaccttcgacacgatcaagggcggcgactacctggtcgaccaggac
gccgccgagatcctcgcgaaggaggccatcgactcggtcctcgacctggagaagatgggc
ctgccgttcaaccgcacgcccgagggcaagatcgaccagcgccggttcggcggtcactcc
cgtaaccacggtgaggccccggtccgccggtcctgctacgcctcggaccgcaccggccac
atgatcctccagacgctgtaccagaactgcgtcaaggagggcgtggagttcttcaacgag
ttctacgtgctcgacctgctgctccaggacgtcgacggcgtcaagaagtccgcgggcgtc
gtcgcgtacgagctggccaccggcgagatccacgtcttccaggcgaagtcgatcgtcttc
gcctccggcggcaccggcaagttcttcaaggtgacctccaacgcgcacaccctgaccggt
gacggccaggccgccgcctaccgccgcgggctgccgctggaggacatggagttcttccag
ttccacccgaccggcatctggcggatgggcatcctgctgacggagggcgcccgtggtgag
ggcggcatcctccgcaacaaggacggcgagcgcttcatggagaagtacgcgcccgtcatg
aaggacctcgcctcgcgtgacgtcgtctcgcgctccatctacacggagatccgcgagggc
cgcggctgcggtcccgacggcgaccacgtctacctggacctcacgcacctcccgccggag
cagctggacgccaagctcccggacatcaccgagttcgcgcgcacgtacctcggcatcgag
ccctacacggacccgatcccgatccagccgaccgcgcactacgccatgggcggcatcccg
accaacgtcgagggtgaggtcctggcggacaacaccaccgtcgtgccgggcctgtacgcg
gccggcgaggtcgcctgcgtctccgtgcacggcgccaaccgcctgggcaccaactcgctg
ctggacatcaacgtgttcggccgccgggccggcatcgcggcggcggagtactcctcctcg
gccgacttcgtcgagctgcccgaggaccccgcccagcaggtcgtcgagcaggtcgagcgg
ctgcgcaactcctccggcaccgagcgggtcaccgagatccgcaaggagctccaggagtgc
atggacgccaacgtgatggtgttccgcaccgagcagacgatcaagaccgcggtcgagaag
atcggcgagctgcgcgagcgctaccggaacgtggccatccaggacaagggcaagcggttc
aacaccgacctgctggaggccatcgagctgggcaacctgctcgacctggccgaggtcatg
gcggtctccgcgctcgcccgcaaggagtcccgcggcggtcactaccgcgaggactacccc
aaccgcgacgacgtcaacttcatgcggcacaccatggcgtaccgcgaggtgggcgcagac
ggcaccgagtcgatccgtctcgactacaagccggtcgtgcagacccgctaccagccgatg
gagcgtaagtactga

DBGET integrated database retrieval system