KEGG   Streptomyces lydicus 103: SL103_31380Help
Entry
SL103_31380       CDS       T04699                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
slc  Streptomyces lydicus 103
Pathway
slc00020  Citrate cycle (TCA cycle)
slc00190  Oxidative phosphorylation
slc00650  Butanoate metabolism
slc01100  Metabolic pathways
slc01110  Biosynthesis of secondary metabolites
slc01120  Microbial metabolism in diverse environments
slc01130  Biosynthesis of antibiotics
slc01200  Carbon metabolism
Module
slc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
slc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
slc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:slc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SL103_31380
   00650 Butanoate metabolism
    SL103_31380
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SL103_31380
Enzymes [BR:slc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SL103_31380
    1.3.5.4  fumarate reductase (quinol)
     SL103_31380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_7 Fer4_9 Fer4_16 Fer4 Fer4_4 Fer4_18 Fer4_6 Fer4_2 Fer4_21 Fer4_15
Motif
Other DBs
NCBI-ProteinID: AOP50162
UniProt: A0A1D7VTR9
LinkDB All DBs
Position
7240823..7241599
Genome map
AA seq 258 aa AA seqDB search
MSTPTLEKADEAGTPEPGFVDSPYITVTFRIRRFNPEVSDEASWQDFQLEIDPKERVLDA
LHKIKWELDGSLTFRRSCAHGICGSDAMRINGRNRLACKTLIKDINPEKPITVEAIKGLT
VMKDLVVDMEPFFQAYRDVMPFLITTGNEPTRERLQSAEDRERFDDTTKCILCAACTSSC
PVFWNDGQYFGPAAIVNAHRFIFDSRDEGGEQRLEILNDKDGVWRCRTTFNCTDACPRGI
EVTKAIQEVKRALITRRF
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccccgactctggaaaaggcggacgaggccggcacgcccgagcccggtttcgtc
gactccccctacatcacggtcaccttccggatccgccggttcaacccggaggtctccgac
gaggccagctggcaggacttccagctggagatcgaccccaaggagcgcgtcctggacgcc
ctccacaagatcaagtgggagctcgacggttcgctgaccttccgccgctcctgcgcccac
ggcatctgcggctcggacgccatgcggatcaacggccgtaaccggctggcctgcaagacg
ctgatcaaggacatcaacccggagaagccgatcaccgtcgaggccatcaagggcctgacc
gtgatgaaggaccttgtcgtcgacatggagcccttcttccaggcgtaccgcgacgtgatg
ccgttcctgatcacgaccggcaacgagccgacccgtgagcgtctgcagtccgccgaggac
cgtgagcgcttcgacgacaccaccaagtgcatcctgtgcgccgcctgcacgtcctcgtgc
ccggtgttctggaacgacggccagtacttcggcccggcggcgatcgtcaacgcgcaccgc
ttcatcttcgacagccgtgacgagggtggcgagcagcgcctggagatcctcaacgacaag
gacggcgtctggcgctgccggaccacgttcaactgcacggacgcctgcccgcgcggtatc
gaggtcaccaaggcgatccaggaggtcaagcgagcgctgatcacccggcgcttctga

DBGET integrated database retrieval system