KEGG   Streptomyces lydicus 103: SL103_31600Help
Entry
SL103_31600       CDS       T04699                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
slc  Streptomyces lydicus 103
Pathway
slc00020  Citrate cycle (TCA cycle)
slc00270  Cysteine and methionine metabolism
slc00620  Pyruvate metabolism
slc00630  Glyoxylate and dicarboxylate metabolism
slc00680  Methane metabolism
slc01100  Metabolic pathways
slc01110  Biosynthesis of secondary metabolites
slc01120  Microbial metabolism in diverse environments
slc01130  Biosynthesis of antibiotics
slc01200  Carbon metabolism
Module
slc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
slc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
slc_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:slc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SL103_31600
   00620 Pyruvate metabolism
    SL103_31600
   00630 Glyoxylate and dicarboxylate metabolism
    SL103_31600
  Energy metabolism
   00680 Methane metabolism
    SL103_31600
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SL103_31600
Enzymes [BR:slc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     SL103_31600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: AOP50205
UniProt: A0A1D7VTV4
LinkDB All DBs
Position
complement(7290119..7291108)
Genome map
AA seq 329 aa AA seqDB search
MTRTPVNVTVTGAAGQIGYALLFRIASGHLLGADVPVKLRLLEIPQGLKAAEGTAMELED
CAFPLLQGIDISDDPNVAFDGANVALLVGARPRTKGMERGDLLEANGGIFKPQGKAINDH
AADDIKVLVVGNPANTNALIAQAAAPDVPRERFTAMTRLDHNRAISQLAAKTGAPVSEIK
KLTIWGNHSATQYPDIFHATVAGKNAAEIVNDEKWLAENFIPTVAKRGAAIIEARGASSA
ASAANAAIDHVHTWVNGTADGDWTSMGIPSDGSYGVPEGLISSFPVTTKDGRYEIVQGLE
VNDFSRERINASVKELEEEREAVRALGLL
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcactcccgtcaatgtcaccgtcaccggcgccgccggccagatcggttacgca
ctcctcttccgcatcgcttccggtcatctgctcggcgcggacgtgccggtgaagctgcgc
ctcctggagatcccgcagggtctgaaggccgccgagggcaccgcgatggagctggaggac
tgcgccttcccgctgctccagggcatcgacatctcggacgacccgaacgtggccttcgac
ggcgcgaacgtcgccctgctcgtcggcgcccgcccccgtaccaagggcatggagcgcggc
gacctcctggaggccaacggcggcatcttcaagccgcagggcaaggccatcaacgaccac
gccgccgacgacatcaaggtcctggtcgtcggcaaccccgccaacaccaacgcgctgatc
gcgcaggccgccgcgccggacgtaccgcgcgagcgcttcaccgcgatgacccgcctggac
cacaaccgcgccatctcgcagctcgcggcgaagaccggcgccccggtctccgagatcaag
aagctgacgatctggggcaaccactccgcgacccagtacccggacatcttccacgccacg
gtcgccggcaagaacgccgccgagatcgtcaacgacgagaagtggctggccgagaacttc
atcccgaccgtcgccaagcgcggtgcggcgatcatcgaggcccgtggcgcgtcctccgcg
gcctccgccgccaacgcggccatcgaccacgtccacacctgggtcaacggcaccgccgac
ggcgactggacctcgatgggcatcccctcggacggctcctacggcgtcccggagggcctg
atctcctcgttccccgtcaccaccaaggacggccgctacgagatcgtgcagggcctggag
gtcaacgacttctcgcgcgagcgcatcaacgcgtccgtcaaggagctggaggaggagcgc
gaggcggtccgcgccctcggcctcctctga

DBGET integrated database retrieval system