KEGG   Streptomyces lydicus 103: SL103_33455Help
Entry
SL103_33455       CDS       T04699                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
slc  Streptomyces lydicus 103
Pathway
slc00250  Alanine, aspartate and glutamate metabolism
slc00410  beta-Alanine metabolism
slc00430  Taurine and hypotaurine metabolism
slc00650  Butanoate metabolism
slc01100  Metabolic pathways
slc01110  Biosynthesis of secondary metabolites
slc01120  Microbial metabolism in diverse environments
slc02024  Quorum sensing
Module
slc_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:slc00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    SL103_33455
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SL103_33455
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SL103_33455
   00430 Taurine and hypotaurine metabolism
    SL103_33455
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    SL103_33455
Enzymes [BR:slc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SL103_33455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AOP50517
UniProt: A0A1D7VUT9
LinkDB All DBs
Position
7707476..7708882
Genome map
AA seq 468 aa AA seqDB search
MTLHKGAPAADRKHIRHPVNPFYGEADPVSGMETSPPRHTLPESPLAPHAAYQFVHDELM
LDGNARLNLATFVTTWMEPQAGVLMAECRDKNMIDKDEYPRTAELERRCVAMLADLWHAP
DAVGCSTTGSSEACMLAGMALKRRWMHRNADRYPASARPNLVMGANVQVCWEKFCNFWEV
EARQVPMQGDRFHLDADSATALCDENTIGVVAILGSTFDGSYEPVADICAALDDLHEKKG
WDIPVHVDGASGAMIAPFLDPELKWDFRLPRVASINTSGHKYGLVYPGVGWALWRDEEAL
PEELVFRVNYLGGDMPTFALNFSRPGAQVAAQYYTFLRLGRAGFRAVQQATRDVARSMAE
RIGSLGDFELLTRGDELPVFAFTTAAHVTAYDVFDVSRRLKERGWLIPAYTFPPDREDLS
VLRVVCRNGFSQDLADLFLADLEQLLQELREQRGPLGRPENEATAFHH
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgcacaaaggcgcgcccgcggccgaccgcaagcacatccggcacccggtcaac
ccgttctacggtgaggccgacccggtttccggcatggagacctcgccgccccggcacacc
ctgcccgagagccccctcgccccgcacgccgcctaccagttcgtccacgacgagctcatg
ctggacggcaacgcccgcctcaacctggcgaccttcgtcaccacctggatggagccgcag
gccggcgtcctgatggcggagtgccgggacaagaacatgatcgacaaggacgagtacccg
cgcaccgccgaactggagcggcgctgcgtggcgatgctcgccgacctgtggcacgccccc
gacgcggtcggctgctccaccaccgggtcgagcgaggcgtgcatgctcgccggcatggcc
ctcaaacgacgctggatgcaccgcaacgccgaccggtacccggcctccgcgcggcccaac
ctcgtcatgggcgccaacgtccaggtctgctgggagaagttctgcaacttctgggaggtc
gaggcccgccaggtcccgatgcagggcgaccgcttccacctcgacgccgactccgccacc
gcgctctgcgacgagaacaccatcggcgtggtggccatcctcggctccaccttcgacggg
tcctacgagccggtggccgacatctgcgcggcgctcgacgacctccacgagaagaagggc
tgggacatcccggtccacgtggacggcgcgtccggcgcgatgatcgccccgttcctcgac
cccgagctgaagtgggacttccggctgccgcgggtcgcctccatcaacacctccggccac
aagtacggcctggtctaccccggcgtcggctgggccctgtggcgcgacgaggaggcgctc
cccgaggaactcgtcttccgcgtcaactacctcggcggcgacatgccgaccttcgccctc
aacttctcccggcccggcgcccaggtggccgcccagtactacaccttcctgcggctcggc
cgggccggtttccgcgccgtccagcaggccacccgggacgtcgcccgctccatggccgaa
cgcatcggctccctgggcgacttcgagctcctcacccgcggcgacgaactgccggtcttc
gccttcaccaccgccgcccacgtcaccgcctacgacgtcttcgacgtgtcccggcgcctg
aaggaacgcggctggctgatccccgcctacaccttcccgcccgaccgcgaggacctctcc
gtcctgcgcgtcgtctgccgcaacggcttctcccaggacctcgccgacctcttcctcgcc
gacctggaacagctcctccaggaactgcgggaacagcggggccccctgggccgcccggag
aacgaggcgaccgccttccaccactga

DBGET integrated database retrieval system