KEGG   Streptomyces lydicus A02: T261_0647Help
Entry
T261_0647         CDS       T03756                                 

Definition
(GenBank) hypothetical protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
sld  Streptomyces lydicus A02
Pathway
sld03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sld00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    T261_0647
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sld03400]
    T261_0647
Enzymes [BR:sld01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     T261_0647
DNA repair and recombination proteins [BR:sld03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     T261_0647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AJT62336
UniProt: A0A0D4DES7
LinkDB All DBs
Position
complement(666478..667374)
Genome map
AA seq 298 aa AA seqDB search
MSPITVVEGRRLSLTNLDKVIYPETGTTKGEVVHYCTITADPLLAHLHDRPLSFLRYPDG
PDGQRFFTKNVPPGTPSWVQTCEVPHTTSGPTRQVLVQDLSSLVWAANLVVELHAPQWTS
GAPGRADRLVLDLDPGAPATVVECCTAAEWLHERLAADGLGVWAKTSGSKGLHLVVPIEP
TPSEWTTAYARSLAVEAQRALPDLVVHKMTKALRPGKVFIDFSQNAAAKTTAVAYTLRAR
ATPTVSTPVTWDEIADCTDPAQLTFRFEAIAPRLARHGDLLAPLLDPGRARPLPHRPR
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccgatcaccgtcgtggaggggcggcgcctctcgctgaccaacctggacaaggtc
atctatcccgagaccggtacgaccaagggcgaggtggtgcactactgcaccatcaccgcg
gacccgctgctcgcgcatctccacgaccggccgctctcgtttctgcgctatcccgacggg
cccgacggccagcgcttcttcaccaagaacgtgccgcccggcaccccctcctgggtgcag
acctgcgaggtgccccatacgacctccgggcccacccgccaggtcctggtgcaggacctc
tcctcgctggtctgggccgcgaacctggtcgtcgaactgcacgcaccccaatggaccagc
ggggcaccgggccgcgccgaccgcctcgtcctcgacctcgaccccggcgccccggccacc
gtcgtcgaatgctgcaccgcggccgagtggctgcacgagcggctcgcggcggacggcctc
ggcgtctgggcgaagaccagcggttccaagggcctgcacctcgtcgtgcccatcgagccg
accccctcggaatggaccacggcctacgccaggagcctcgccgtcgaggcccagcgggcc
ctcccggacctggtcgtccacaagatgaccaaggcgctgcgccccggcaaggtcttcatc
gacttctcccagaacgccgccgccaagaccaccgccgtcgcctacaccctgcgtgcccgc
gccacccccaccgtctccaccccggtcacctgggacgaaatcgcggactgcaccgacccc
gcccaactcaccttccgcttcgaggccatcgcgccccgtctcgcccgccacggcgatctg
ctcgccccgctcctggatcccggccgcgcccggccgctaccccaccggccccggtaa

DBGET integrated database retrieval system