KEGG   Streptomyces lydicus A02: T261_2095
Entry
T261_2095         CDS       T03756                                 

Definition
(GenBank) 2-amino-4,5-dihydroxy-6-oxo-7-(phosphonooxy)heptanoate synthase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
sld  Streptomyces lydicus A02
Pathway
sld00997  Biosynthesis of various secondary metabolites - part 3
sld01100  Metabolic pathways
sld01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sld00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    T261_2095
Enzymes [BR:sld01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     T261_2095
SSDB
Motif
Pfam: DeoC OMPdecase
Other DBs
NCBI-ProteinID: AJT63780
UniProt: A0A0D4DIT4
LinkDB
Position
2252112..2252849
AA seq 245 aa
MDHSVADGPISDAAGFSRIVGDVVAAGADAVVVHKGRARTIEPVLLNGAALIVHLSASTP
HAPDGDAKVLVGGVEEAVRAGADAVSVHINIGSDTEKRQLADLGAVAASCERWGMPLLAM
MYARGPRIADPRDPALLAHVVSIAVDLGADLVKTVAAGSAEDMAGIVAKTPVPVVVAGGT
ADGRDLTDFAHFAMDAGCRGLAVGRRVFHSPDPGAAVRTLAAAVHEPRPETAPNPTSLPE
LAGAM
NT seq 738 nt   +upstreamnt  +downstreamnt
atggaccattccgtggccgacggaccgatctccgacgccgccgggttcagccggatcgtc
ggtgacgtggtggccgccggggccgacgccgtcgtcgtccacaaggggcgcgcccgcacc
atcgaaccggtcctgctgaacggcgccgccctgatcgtccacctcagcgcgagcactccg
cacgcccccgacggcgacgccaaggtgctcgtcggcggcgtcgaggaagcggtacgcgcc
ggggcggacgcggtcagcgtgcacatcaacatcggctcggacaccgagaaacggcagctc
gccgacctcggtgcggtcgcggcgagctgcgagcggtggggcatgccactgctggcaatg
atgtacgcacgggggccgcgcatcgcggatccccgcgaccccgcactcctcgcgcatgtg
gtgagcatcgccgtcgacctcggcgccgacctggtcaagaccgtcgcggcgggctcggct
gaggacatggccggcatcgtcgccaagaccccggtcccggtcgtcgtggccggcggcacc
gccgacggccgtgacctcaccgacttcgcgcacttcgcgatggacgccggctgccgcgga
ctcgcggtcggccgccgggtgttccacagccccgacccgggggcggcggtccgcacactg
gccgccgccgtccatgaaccacgtccggaaaccgccccgaatccaacctccctacccgaa
ctggcaggtgcgatgtga

DBGET integrated database retrieval system