KEGG   Streptomyces lydicus A02: T261_2485Help
Entry
T261_2485         CDS       T03756                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sld  Streptomyces lydicus A02
Pathway
sld00473  D-Alanine metabolism
sld00550  Peptidoglycan biosynthesis
sld01100  Metabolic pathways
sld01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sld00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    T261_2485
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    T261_2485
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    T261_2485
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sld01011]
    T261_2485
Enzymes [BR:sld01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     T261_2485
Peptidoglycan biosynthesis and degradation proteins [BR:sld01011]
 Precursor biosynthesis
  Amino acid ligase
   T261_2485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 ATP-grasp_3 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AJT64164
UniProt: A0A0D4DJM7
LinkDB All DBs
Position
complement(2701473..2702609)
Genome map
AA seq 378 aa AA seqDB search
MSSQTSSHKPRVAVVFGGRSSEHGISVVTAGAVMRAIDREKYDVLPIGITTDGRWALTAD
DPERMAIADRQLPTVAALAESTEGGVVLPVDPTNREIVYTEPGSVPKALGEVDVVFPVLH
GPYGEDGTLQGLLELSGVPYVGSGVLASAVGQDKDYMKRVFTSFGLPVGPYEVIRPREWE
KDPAAARKKIVDFAGDHGWPLFVKPARAGSSIGITKVDGLAGLDEAIEEARRHDPKVIVE
ALLRGREIECGVLEFEDGPRASVPAEIPPVTAHDFYDFEAKYIDSADGIVPAPLTPEQTA
EVQRLAVEAFEAASCEGLVRADFFLQDNGEFVINEINTLPGFTPISMYPRMWQESGVSYP
ELIDRLLQAALTRSTGLR
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgagcagccagacctcctcccacaagccccgcgtcgccgtcgtcttcggcggccgcagc
tccgagcacggcatctccgtggtcaccgccggcgccgtcatgcgcgccatcgaccgcgag
aagtacgacgtgctgcccatcggcatcaccaccgacgggcgctgggcgctgaccgccgac
gaccccgagcggatggccatcgcggaccggcagctgcccaccgtggccgcactcgccgag
tccaccgagggcggggtcgtgctcccggtcgacccgaccaaccgcgagatcgtctacacc
gagcccggctcggtgcccaaggccctcggcgaggtcgacgtcgtcttccccgtcctgcac
ggcccctacggcgaggacggcaccctccagggcctgctggagctctccggcgtcccctac
gtcggctcgggcgtcctcgcctccgccgtcggccaggacaaggactacatgaagcgggtg
ttcacctccttcgggctgcccgtcggcccgtacgaggtcatccgcccccgtgagtgggaa
aaggatcctgccgccgcccgcaagaagatcgtggacttcgccggcgaccacggctggccg
ctgttcgtgaagcccgcacgggccggctcgtcgatcggcatcaccaaggtcgacggcctc
gcgggcctggacgaggccatcgaggaggcccgccgccacgaccccaaggtcatcgtcgag
gcgctgctgcgcggccgcgagatcgagtgcggggtgctggagttcgaggacggcccgcgc
gccagcgtcccggccgagatcccgcccgtcaccgcgcacgacttctacgacttcgaggcc
aagtacatcgactcggccgacggcatcgtgcccgccccgctgacccccgagcagaccgcc
gaggtccagcggctggccgtcgaggccttcgaggcggcctcctgcgagggcctggtgcgc
gcggacttcttcctgcaggacaacggcgagttcgtgatcaacgagatcaatacgctgccc
ggcttcacgcccatctcgatgtacccgcggatgtggcaggagagcggcgtgagctacccg
gagctgatcgaccggctgctgcaggccgcgctgacccgctccacggggctgcgctga

DBGET integrated database retrieval system