KEGG   Streptomyces lydicus A02: T261_2777Help
Entry
T261_2777         CDS       T03756                                 

Definition
(GenBank) Superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
sld  Streptomyces lydicus A02
Brite
KEGG Orthology (KO) [BR:sld00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    T261_2777
Enzymes [BR:sld01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     T261_2777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni BtrH_N
Motif
Other DBs
NCBI-ProteinID: AJT64450
UniProt: A0A0D4DKN5
LinkDB All DBs
Position
3020984..3021379
Genome map
AA seq 131 aa AA seqDB search
MLSRLFAPKVKVSAHCDLPCGVYDPAQARIEAESVKAVQEKYQANEDADFRARAILIKEQ
RAELAKHHVSVLWSDYFKPPHFEKYPQLHTLVNDTLKALSAAKGSNDPKTGEKALELIAE
IDRIFWETKKA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgctttcccgcctgttcgcccccaaggtcaaggtcagcgcccactgcgacctgccctgc
ggcgtgtacgaccccgcccaggcccgcatcgaggccgagtcggtcaaggccgtccaggag
aagtaccaggccaacgaggacgcggacttccgcgcccgcgcgatcctcatcaaggagcag
cgcgccgagctggccaagcaccacgtctcggtgctgtggagcgactacttcaagcccccg
cacttcgagaagtacccccagctgcacacgctggtcaacgacaccctcaaggccctcagc
gccgccaagggctcgaacgacccgaagaccggtgagaaggccctggagctcatcgccgag
atcgaccggatcttctgggagaccaagaaggcctga

DBGET integrated database retrieval system