KEGG   Streptomyces lydicus A02: T261_3733Help
Entry
T261_3733         CDS       T03756                                 

Definition
(GenBank) Putative aldehyde dehydrogenase YfmT
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sld  Streptomyces lydicus A02
Pathway
sld00010  Glycolysis / Gluconeogenesis
sld00053  Ascorbate and aldarate metabolism
sld00071  Fatty acid degradation
sld00280  Valine, leucine and isoleucine degradation
sld00310  Lysine degradation
sld00330  Arginine and proline metabolism
sld00340  Histidine metabolism
sld00380  Tryptophan metabolism
sld00410  beta-Alanine metabolism
sld00561  Glycerolipid metabolism
sld00620  Pyruvate metabolism
sld00625  Chloroalkane and chloroalkene degradation
sld00903  Limonene and pinene degradation
sld01100  Metabolic pathways
sld01110  Biosynthesis of secondary metabolites
sld01120  Microbial metabolism in diverse environments
sld01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sld00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    T261_3733
   00053 Ascorbate and aldarate metabolism
    T261_3733
   00620 Pyruvate metabolism
    T261_3733
  09103 Lipid metabolism
   00071 Fatty acid degradation
    T261_3733
   00561 Glycerolipid metabolism
    T261_3733
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    T261_3733
   00310 Lysine degradation
    T261_3733
   00330 Arginine and proline metabolism
    T261_3733
   00340 Histidine metabolism
    T261_3733
   00380 Tryptophan metabolism
    T261_3733
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    T261_3733
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    T261_3733
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    T261_3733
Enzymes [BR:sld01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     T261_3733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AJT65398
UniProt: A0A0D4DNY0
LinkDB All DBs
Position
complement(4011388..4012845)
Genome map
AA seq 485 aa AA seqDB search
MSYFDELAYQFIDGEWRSGSGSWDIVDFNPYNGEKLSSITVATVEEIDQAYRAAERAQRE
WGATNPYTRRLVFERALRIIDEREDELGAAIAAEVGGTLAKVGFELHLVREFLREAMQLA
LRPEGRILPSPIDGKENRLYRLPVGVVGVISPFNFPFLLSIKSVAPALALGNAVVLKPHQ
NTPICGGGLVAKIFEEAGLPAGLLNVVVTDIAEIGDALIEHPVPKTISFTGSEKVGRHVA
TVAAANFKHAILELGGNSALVVLDDADIDYAVDAAVFSRFVHQGQVCMAANRVLVDRAVE
REFTEKFVAKVASLKVGDPTDPGTHIGPLINEGQAEAIAALVDRAVADGASALLHGETRG
TLVAPSVLGGLPADSPLLTQEIFGPVVLLIPFDGDDEAVRITNATPYGLSGAVHTGDIER
GVRFAKRVDTGMIHINDGTVHDEPIVPFGGEKSSGVGRLNGEAMVEAFTTTKWISIQHGR
SQFPF
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtcctacttcgacgagttggcgtatcagttcatcgacggcgagtggcgctcgggcagc
ggctcttgggacatcgtcgatttcaatccgtacaacggcgaaaagctgtcctccataacc
gttgccacggtcgaggagatcgatcaggcctaccgcgccgccgagcgcgcgcagcgggaa
tggggtgcgaccaatccctacacccggcgcctggtcttcgagcgggcgctgcggatcatc
gacgagcgcgaggacgaactgggcgcggcgatcgccgcggaggtgggcggcacgctcgcg
aaggtgggcttcgagctgcatctcgtacgggaattcctgcgcgaggcgatgcagctggcg
ctgcggcccgagggccggatcctgccctcgcccatcgacggcaaggagaaccgcctctac
cggctgccggtcggtgtggtgggcgtgatctcccccttcaacttccccttcctcctctcc
atcaagtccgtcgcgcccgccctcgcgctgggcaacgccgtcgtcctcaagccgcaccag
aacaccccgatctgcggcggcggactggtcgccaagatcttcgaggaggccgggctgccg
gccgggctgctcaatgtggtggtcaccgatatcgcggagatcggggatgcgctgatcgag
cacccggtgcccaagacgatctccttcaccggctcggagaaggtcggccggcatgtcgcg
acggtcgcggcggcgaacttcaagcacgccatcctggagctgggcggcaacagcgcgctg
gtcgtcctggacgacgccgatatcgactacgccgtcgacgccgccgtcttcagccgcttc
gtccaccagggccaggtctgtatggccgccaaccgtgtgctggtcgaccgtgccgtggag
cgggagttcaccgagaagttcgtcgccaaggtcgcgtcgctgaaggtcggcgacccgacg
gatcccggtacgcacatcggcccgctgatcaacgagggccaggccgaggccatcgccgcg
ctggtggaccgggccgtcgcggacggcgcctcggcgctcctgcacggcgagacccggggc
accctcgtcgcgccgagcgtcctcggcggcctgccggcggactccccgctcctgacccag
gagatcttcggcccggtggtcctgctgatcccgttcgacggtgacgacgaggccgtacgg
atcaccaacgcgacgccgtacgggctcagcggtgccgtgcacaccggggacatcgagcgc
ggggtgcggttcgccaagcgcgtcgataccgggatgatccatatcaacgacggcacggtg
cacgacgagccgatcgtgccgttcggcggcgagaagagctccggggtggggcggctgaac
ggcgaggcgatggtggaggcgttcacgacgacgaagtggatctccattcagcacgggcgg
tcgcagttcccgttctga

DBGET integrated database retrieval system