KEGG   Streptomyces lydicus A02: T261_3818
Entry
T261_3818         CDS       T03756                                 

Definition
(GenBank) Streptomycin-6-phosphate phosphatase
  KO
K04342  streptomycin-6-phosphatase [EC:3.1.3.39]
Organism
sld  Streptomyces lydicus A02
Pathway
sld00521  Streptomycin biosynthesis
sld01100  Metabolic pathways
sld01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sld00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    T261_3818
Enzymes [BR:sld01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.39  streptomycin-6-phosphatase
     T261_3818
SSDB
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase
Other DBs
NCBI-ProteinID: AJT65481
UniProt: A0A0D4DNL5
LinkDB
Position
complement(4092061..4093434)
AA seq 457 aa
MRRLRLSRRRAIAGAAVLLATGVAIPAGAAAFGPKDQAARAIQGGKAKNVILLIGDGMGD
SEITLARNYTVGAAGRLNMDRFPLTGAYTTYAVDKNGKPDYVTDSAASGSGWATGHKTVN
GRISKTPDTDKPLPTILELAQKNGYATGSVTTAELTDATPAVLASHVSDRSCQGPADMAK
CAADTLAKGGPGSIAEQSVNHKVDVLLGGGKQRFDQKITEGPYQGMTVAEQARKLGYQIV
TDKQGLKDFKGGKPVLGLFAPGTVPVEWTGKPAAVGGTDPQRCTTGNPQRPDGTPALDEQ
ATKAIQLLENKQKSQQGHGRDKGFFLQIEGASIDKQDHAADPCGQIGETAAFDRAVKVAR
DYAAKHPDTLVVTTADHGHSSQIVPLEANPPGLSSTLVTDEGAQMKVNYSTNTPGQSQEH
TGTEVRIAAQGPQAYRVLGITNQTDLFTTIRKALQLR
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgcgaagactgcgcctgtcccgccgccgcgccatagccggcgccgccgtgctgctcgcc
accggtgtggccatccccgcgggagcggccgcgttcggccccaaggaccaggcagcgcgc
gcgatccagggcggcaaggcgaagaacgtcatcctgctgatcggcgacgggatgggtgac
tcggagatcaccctggcgcggaactacaccgtgggcgccgcgggccggctcaacatggac
aggttcccgctgaccggcgcgtacacgacgtacgcggtcgacaagaacggcaagccggac
tacgtcaccgactccgccgccagcggcagcggttgggccaccggacacaagacggtcaac
ggccgcatctccaagacaccggacaccgacaagccgctgccgacgatcctcgagctggcg
cagaagaacggttacgccaccgggtcggtcaccaccgccgaactgaccgacgccacaccg
gccgtgcttgcctcccacgtcagcgaccgcagctgccagggcccggccgacatggccaag
tgcgcggccgacaccctcgccaagggcggccccggctcgatcgccgagcagagcgtcaac
cacaaggtggacgtgctgctgggtggcggaaagcagcgcttcgaccagaagatcaccgag
ggcccgtaccagggcatgacggtggcggagcaggcgcgcaagctcggctaccagatcgtc
accgacaagcagggcctcaaggacttcaagggcggcaagccggtcctcggactcttcgcg
ccgggcaccgtccccgtcgagtggaccggcaagcccgccgccgtcggaggcaccgacccg
cagcgctgcaccaccggcaacccgcagcgtcccgacggcaccccggccctcgacgagcag
gccaccaaggcgatccaactgctggagaacaagcagaagtcgcagcagggccacggccgg
gacaagggcttcttcctccagatcgagggcgcctcgatcgacaagcaggaccacgccgcc
gacccctgcggccagatcggcgagaccgccgcgttcgaccgcgcggtgaaggtggcccgc
gactacgccgccaagcaccctgacacgctcgtggtcaccaccgccgaccacggccactcc
agccagatcgtgccgctggaggcgaacccgcccggcctgtcctccaccctcgtcaccgat
gagggcgcccagatgaaggtcaactactcgaccaacacgccgggccagtcccaggagcac
accggcaccgaggtacggatcgccgcacagggcccgcaggcataccgggtcctgggcatc
accaaccagaccgacctcttcaccaccatccgcaaggcgctgcagcttcgctga

DBGET integrated database retrieval system