KEGG   Streptomyces lydicus A02: T261_4308Help
Entry
T261_4308         CDS       T03756                                 

Definition
(GenBank) putative serine/threonine-protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sld  Streptomyces lydicus A02
Brite
KEGG Orthology (KO) [BR:sld00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sld01001]
    T261_4308
Enzymes [BR:sld01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     T261_4308
Protein kinases [BR:sld01001]
 Serine/threonine kinases: Other
  Bacterial family
   T261_4308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Pkinase_fungal Kdo Seadorna_VP7 Kinase-like
Motif
Other DBs
NCBI-ProteinID: AJT65962
UniProt: A0A0D4DQU3
LinkDB All DBs
Position
4606675..4608339
Genome map
AA seq 554 aa AA seqDB search
MDARGPQNFPAPGRALAASSPGARSRAGRNPSPLLHVFRRVGVDGPWRNPVEHRMLGERY
ELVEQLGHGGMGTVYRAVDHRLRRTVAVKTLSAELALQPEFLTRFQREAHAAAALNHPGV
ATVHDVGEDDAGGGVEPYLVMEYVEGRTLSRVLNDGAMAVAQAVDITRQVLQALEHSHRH
SIVHRDIKPANVMLTGTGTVKVVDFGIAKALSEVATRLTGTGVAVGTPAYLAPEQINGHE
TDHRTDLYAVGCLLYELLTGRPPYTGDSPFSVMHQHLAAEPVPPSRLRPELPPALDAVVV
KALSKDREDRFAGASAMKAAVGEAAGDGPAVPVRTPARTPTRTPTTVDPAPAAVVSAPAA
VVSAPPAVDPAPADPSPPPARRRWARVVFHPTAEGAVALLGCVLSAAVSRTDMIEVGQFD
RVALLAAVAGAVLLLWSARLACAVAWGPVAEAVAAWSELSRGSVGWDTRYVMIALVLGIV
GALCLAAGYRDERSGGFALVAFWFTTLTAVWFFLDDLHKIGVFYVLLLGVTLAVGAQVLK
ARTRPAAADAAQRR
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggatgcgcgcggtccgcagaattttccggcaccgggccgggctctcgccgcatcgtca
cccggcgcccgcagccgggccgggcggaacccgtcccccctcctgcacgtcttccggcgt
gttggcgttgacggtccgtggaggaatccggtggagcacaggatgttgggggagcgctac
gagctggtggagcagctcgggcacggcggtatgggcacggtctaccgggccgtcgaccac
cggctgcgccgtaccgtcgccgtgaagaccctctccgccgagctggcgctgcagccggag
ttcctcacccgcttccagcgcgaggcgcatgccgccgccgcactcaaccaccccggggtg
gccaccgttcacgacgtgggggaggacgatgcgggcggcggcgtcgagccgtatctggtg
atggagtacgtcgagggccgcacgctcagccgggtgctgaacgacggtgcgatggcggtg
gcgcaggccgtcgacatcacgcgtcaggtgctgcaggccctggagcacagtcaccggcac
tccatagtccaccgggacatcaagccggcgaacgtcatgctcaccggtacgggcacggtc
aaggtcgtcgacttcggcatcgccaaggccctcagcgaggtggccacccggctgaccggg
accggcgtcgcggtcggcacgcccgcctatctggccccggagcagatcaacgggcacgag
accgaccaccgcacggacctgtacgccgtgggctgtctgctgtacgagctgctgacgggg
cgtcccccgtacaccggcgactcgcccttctccgtgatgcatcagcacctggctgcggag
ccggtgccgccctcccggctccgcccggagctgccgcccgccctggacgcggtggtcgtc
aaggccctgagcaaggaccgggaggaccgcttcgcgggcgcgtccgcgatgaaggcggcg
gtcggggaggccgccggggacgggccggcggttccggtacggacgcccgccaggacgccc
acgcggacgcccacgaccgtcgatccggcaccggcagccgtggtctccgcaccggcagcc
gtggtctccgcgccgcccgccgtggatcccgcgcccgcggacccctcgccgccgcccgcc
cgccgccggtgggccagagtcgtcttccaccccacggccgagggcgcggtcgcgctgctc
ggctgtgtgctgtccgcggcggtctcccgtacggacatgatcgaggtcggccagttcgac
cgcgtcgccctgctcgccgccgtggcgggggcggtgctgctgctgtggtccgcgcggctc
gcctgcgcggtggcctggggcccggtggcggaggccgtggcggcgtggtccgaactctcc
cgcggctccgtcggctgggacacccgctacgtcatgatcgccctggtcctgggcatcgtc
ggcgcgctgtgcctcgccgccgggtaccgggacgagcgctcgggcggattcgcgctggtg
gcgttctggttcaccaccctgacagccgtctggttcttcctcgacgatctgcacaagatc
ggggtgttctacgtgctgttgctgggcgtgacgctcgccgtgggggcacaggtgctgaag
gcccggacccggccggcggcggccgatgcggcgcaacggcgctga

DBGET integrated database retrieval system