KEGG   Streptomyces lydicus A02: T261_4950Help
Entry
T261_4950         CDS       T03756                                 

Definition
(GenBank) Beta-galactosidase bgaB
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
sld  Streptomyces lydicus A02
Pathway
sld00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:sld00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    T261_4950
Enzymes [BR:sld01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     T261_4950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_2_C DUF4350 Glyco_hydro_35 Glyco_hydro_14
Motif
Other DBs
NCBI-ProteinID: AJT66587
UniProt: A0A0D4DSQ3
LinkDB All DBs
Position
complement(5257092..5259119)
Genome map
AA seq 675 aa AA seqDB search
MRGTGIHFGGDYNPEQWPEEVWAEDLKLMKAAHVTMVTAGIFSWAKVEPRPGEWDFGWFD
RVMDGLAGAGIAVCLATMTASPPPWLSRAHPGILPEDPDGRRRWPGGRQHYCPSSPVYRA
HAVRLVEQLATRYAGHPALAMWHVGNEYGCHTRQCFCAVSAEDFRTWLRARYETIGALNE
AWSTAFWSQQYGDFDEVLPPRTAPTFPNPAQQLDYLRFGDAALRACYLAEKEVLDRLTPG
VPVTTNLMPQHKPVDAFAWSAHMDAMALDFYQDPYAADDHIRAGYVFDLMRSARSGQPWL
LLEQAPGAVNWRPRNGPKPPGAMRLWSWQAIAQGADAVLFFQWRQSLGGAEKFHSAMLPH
GGTDTRTFREVQGLGRELASLPEIAGTRSRASVALLADWHSWWALEVDSKPSTALDHSEI
ALAHYRPLFEAGVACDVVPPQRELTGYRLVVVPNLYLLTARDAERLTAYVRGGGHLVVSF
FSGIVDEHDRVHPGGYPAPLRRLLGLRVEEFWPLDAGRTVAVGGGRYTGAADLWSEAIDL
EGAEALACFTEGELAGRPAVTRHAYGRGAVWYVGTRLEPGLMRALLDDVREAAGVAPVLP
GLPAGVQATVREDPEGRYGRFTFLLNHRAEAVEVALPAPMTDALADTPEAAAAPADRITL
AGRGVAVLTDAGRVP
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggcaccggcattcacttcggcggcgactacaaccccgagcagtggcccgaggag
gtgtgggccgaggatctgaagctgatgaaggcggcccacgtcaccatggtcaccgccggg
atcttctcctgggcgaaggtcgaaccccggcccggggaatgggacttcgggtggttcgac
agggtgatggacgggctggcgggcgccgggatcgcggtgtgcctggcgacgatgacggcc
tctcccccgccctggctgtcccgcgcacaccccgggatcctgcccgaggacccggacggc
cggcgccgctggcccggcggccgtcagcactactgcccctccagccccgtctaccgcgcc
cacgccgtccgcctcgtcgagcagctggccacccgctacgccggccatccggcgctggcc
atgtggcatgtgggcaacgagtacgggtgccatacccggcagtgcttctgcgcggtgtcg
gccgaggacttccgcacctggctgcgggcccggtacgagaccatcggggcgctgaacgag
gcctggtcgacggccttctggtcgcagcagtacggggatttcgacgaggtgctgccgccc
cgtacggcgcccaccttccccaatccggcgcagcagctggattacctgcggttcggcgat
gcggcgctgcgggcctgctacctcgccgagaaggaggtgctggaccggctcacacccggt
gtgcccgtcaccaccaatctgatgccgcagcacaagccggtcgatgcgttcgcctggtcc
gcgcacatggatgccatggcgctggacttctaccaggatccgtatgcggcggacgaccac
atccgggccgggtatgtcttcgacctgatgcggtccgcccgctccggtcagccgtggctg
ctgctggagcaggcgccgggcgcggtcaactggcggccgcgcaacggccccaagccgccg
ggcgcgatgcggctgtggagctggcaggccatcgcccagggcgcggacgcggtgctgttc
ttccagtggcggcagtcgctgggcggggcggagaagttccactcggcgatgctgccgcac
ggcgggacggacacccgtacgttccgtgaagtgcagggattgggacgggagttggcgtcg
ctgccggagatcgcggggacgcggtcgcgggcttcggtggcgctgctggcggactggcac
agctggtgggcgctggaggtggactccaaaccgtcgaccgcgctggatcattcggagatc
gcgctggcgcactaccggccgctgttcgaggcgggggtggcctgcgacgtggtgccgccg
cagcgggagctgacggggtaccggctcgtcgtcgtacccaatctgtatctgctcacggcc
cgcgacgcggagcggctgaccgcgtatgtacggggtggggggcacctggtggtgtcgttc
ttctcggggatcgtggacgagcacgaccgggtgcaccccgggggatatccggcgccgttg
cggaggctgctggggctgcgggtggaggagttctggccgctggacgccggccgtacggtg
gcggtcgggggcggtaggtacacgggggcggccgatctgtggtcggaggccatcgatctg
gaaggggccgaggcgctcgcgtgtttcacggagggggagctggcggggcggcccgcggtg
acccggcatgcgtacgggcggggcgccgtctggtacgtcggcacgcggctcgaaccgggg
ctgatgcgggccctgctggacgacgtacgggaggcggccggggtggcgcccgtgctgccg
ggcctgccggcgggtgtccaggcgaccgtccgcgaggacccggaggggcggtacgggcgg
ttcaccttcctgctcaaccaccgggccgaggcggtcgaggtcgcgctccccgcgccgatg
acggatgcgctggcggacacccccgaggccgccgccgcacccgccgaccggatcaccctg
gcggggcggggcgtggccgtactgaccgatgcggggcgggtcccttag

DBGET integrated database retrieval system