KEGG   Streptomyces leeuwenhoekii: cxmHHelp
Entry
cxmH              CDS       T04414                                 

Gene name
cxmH
Definition
(GenBank) RifH homologue, AminoDAHP synthase, AHBA biosynthesis
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
sle  Streptomyces leeuwenhoekii
Pathway
sle00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sle01100  Metabolic pathways
sle01110  Biosynthesis of secondary metabolites
sle01130  Biosynthesis of antibiotics
sle01230  Biosynthesis of amino acids
sle02024  Quorum sensing
Module
sle_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:sle00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    cxmH (cxmH)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    cxmH (cxmH)
Enzymes [BR:sle01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     cxmH (cxmH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_2
Motif
Other DBs
NCBI-ProteinID: CQR60490
UniProt: A0A0F7VMF4
LinkDB All DBs
Position
chromosome:complement(1228390..1229610)
Genome map
AA seq 406 aa AA seqDB search
MRRFLPAAASCPADRTLARRLDAALARPAAQQPHWPDPARARTVLRRLDRADPIVVPEET
AVLSARLASVARGEAFLLQGGDCAETFADTTEPHLRANLRTLNEMAGVLAGAAGLPVVKV
ARMAGQWAKPRSRVLDPHGLPVYRGDIVNSAQATTAARTPDPDRMLRAHAHAARAMDIVR
AAAPGGDVHVSHELLLLDYERSVLWVDTGCPEPRLSSGLADFLWIGERTRRLDGAHLAFA
ELLSNPVGVKIGPGVTPELAVEYVRRLDPHGTPGRLTLVSRMGHDRVRDVLPPIVEKVNA
SGHEVIWQCDPMHGNTRTSRNGYKTRHFDQVADEIAGFFEVHRRLGTHPGGLHVEVTGED
VTECLGGTPALTEADLPARYRTACDPRLNAAQSLQLAHLVADLLRG
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaggcggttccttcccgctgccgcgtcctgcccggcggaccggacgctggctcgccgg
ctcgacgcggcgctggcccggcccgccgcgcagcagccgcactggccggatcccgcacgg
gcgcgcacggtcctgcgccggctggaccgcgcggacccgatcgtcgtaccggaggagacg
gccgtactgtcggcgcggctggcgtccgtcgcccgcggcgaagcgttcctgctccagggc
ggcgactgcgccgaaaccttcgccgacaccaccgagccgcacctgcgggccaatctgcgt
accctgaacgagatggcgggggtgctggccggtgcggccgggctgcccgtggtgaaggtg
gcgcggatggccgggcagtgggccaagccccgctcccgcgtgctcgacccgcacggcctg
ccggtctaccgcggcgacatcgtcaactccgcgcaggccaccaccgccgcccgcaccccc
gacccggaccggatgctgcgcgcccacgcccacgcggcccgcgccatggacatcgtccgc
gcggccgcgcccggcggcgacgtccacgtcagccacgaactgctcctgctcgactacgag
cggagcgtgctgtgggtggacaccggctgccccgaaccccggctctccagcggcctggcg
gacttcctgtggatcggcgagcgcacccgccgcctcgacggcgcccacctcgccttcgcg
gagctgctgtccaaccccgtcggcgtgaagatcggccccggagtgacaccggaactggcc
gtcgagtacgtacgccgcctcgacccccacggcaccccgggcaggctgaccctggtcagc
cggatgggacacgaccgcgtccgggacgtgctgccgccgatcgtggagaaggtcaacgcc
tccgggcacgaggtgatctggcagtgcgacccgatgcacggcaacacccgcacctcccgc
aacggctacaagacccggcacttcgatcaggtcgccgacgagatcgccgggttcttcgag
gtgcaccggcggctcggcacccaccccggcggcctccatgtggaggtcaccggggaggac
gtcaccgaatgcctcggcggcacccccgcgctcaccgaggccgacctgcccgcccgctac
cgcaccgcctgcgacccgcggctcaacgccgcccagtccctccaactcgcccacctcgtc
gcggacctgctacgcggctga

DBGET integrated database retrieval system