KEGG   Streptomyces leeuwenhoekii: sle_08270Help
Entry
sle_08270         CDS       T04414                                 

Gene name
sle_08270
Definition
(GenBank) Isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
sle  Streptomyces leeuwenhoekii
Pathway
sle00020  Citrate cycle (TCA cycle)
sle00480  Glutathione metabolism
sle01100  Metabolic pathways
sle01110  Biosynthesis of secondary metabolites
sle01120  Microbial metabolism in diverse environments
sle01130  Biosynthesis of antibiotics
sle01200  Carbon metabolism
sle01210  2-Oxocarboxylic acid metabolism
sle01230  Biosynthesis of amino acids
Module
sle_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sle_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:sle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    sle_08270 (sle_08270)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    sle_08270 (sle_08270)
Enzymes [BR:sle01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     sle_08270 (sle_08270)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: CQR60290
UniProt: A0A0F7VM70
LinkDB All DBs
Position
chromosome:980462..982681
Genome map
AA seq 739 aa AA seqDB search
MTDSTIIYTHTDEAPALATYSFLPVVQAYASQAGVAVETRDISLAGRIIAVFPEYLTEDQ
RIPDALAELGELAKTPAANIIKLPNISASIPQLKAAVAELQGQGYALPDYPDDPKTDEER
EIRARYDKVKGSAVNPVLREGNSDRRAPASVKNYAKTHPHRMGAWTSESRTNVATMGEND
FRSTEKSVIIAEDGTLRIELAGDDGSTTVLRESVPVQKGEVVDASVMRVAALREFLAAQV
ARAKQEGVLFSVHLKATMMKVSDPIIFGHVVRAFFPKTFAKYGATLAAAGLTPNDGLGGI
YKGLEALPEGAEIKASFDAELAEGPELAMVDSDKGITNLHVPSDVIIDASMPAMIRTSGH
MWGPDGQEHDALAVIPDSSYAGVYQAVIDDCRANGAYDPATMGSVPNVGLMAQKAEEYGS
HDKTFEIPVTGTVRLVDQNGDAVIEQPVSAGDIFRACQTKDAPIKDWVKLAVTRARATGD
PAVFWLDATRAHDANLIKKVEQYLPEHDTEGLEIKILSPVEATKLSVERIRRGENTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLMAGGGLFETGAGGSAPKHVQQLVKENYLRWD
SLGEFFALVPSLEQYAEATGNARAKVLADTLDRATATFLNEDKSPTRRVGGIDNRGSHFY
LSLYWAQELARQTDDADLAKAFAPLAETLAANEQKIVDELNAVQGKPVDIGGYYQPDPAK
AAEVMRPSATWNEALASLS
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
gtgactgactcgaccatcatctacacacacactgacgaggccccggccctggcgacgtat
tccttcctgccggtggtccaggcgtacgcctcgcaggcgggcgtcgcggtggagacccgc
gacatctcgctggccggacgcatcatcgccgtgttcccggagtacctcaccgaggaccag
cgcatcccggacgccctcgcggagctgggcgagctcgccaagacgccggccgccaacatc
atcaagctgccgaacatctcggcgtcgatcccgcagctcaaggcggccgtcgccgagctc
cagggccagggctacgcgctgccggactacccggacgacccgaagaccgacgaggagcgc
gagatccgcgcccgctacgacaaggtcaagggctccgcggtcaacccggtcctgcgcgag
ggcaactccgaccgccgcgccccggcgtcggtgaagaactacgccaagacccacccgcac
cgcatgggcgcctggacctccgagtccaggaccaacgtggcgaccatgggcgagaacgac
ttccgctccaccgagaagtccgtgatcatcgccgaggacggcacgctgcgcatcgagctg
gccggcgacgacggctccaccacggtcctgcgcgagtccgtgccggtccagaagggcgag
gtcgtcgacgcctccgtgatgcgggtcgccgcgctgcgcgagttcctcgccgcgcaggtc
gcccgcgccaagcaggagggcgtgctgttctccgtgcacttgaaggccacgatgatgaag
gtctccgacccgatcatcttcggtcacgtggtgcgcgccttcttcccgaagacgttcgcg
aagtacggtgcgacgctcgccgcggccggcctcaccccgaacgacggcctcggcggcatc
tacaagggcctggaggccctgcccgaaggcgccgagatcaaggcgtccttcgacgccgag
ctggccgagggcccggagctggcgatggtcgactccgacaagggcatcaccaacctgcac
gtcccctcggacgtcatcatcgacgcctcgatgccggccatgattcgcacctccggccac
atgtggggcccggacggccaggagcacgacgccctcgccgtcatcccggactcctcctac
gcgggcgtgtaccaggccgtcatcgacgactgccgcgccaacggcgcctacgacccggcc
accatgggctcggtgcccaacgtcggcctcatggcgcagaaggccgaggagtacggcagc
cacgacaagaccttcgagatcccggtcacgggcacggtccgcctggtcgaccagaacggc
gacgccgtcatcgagcagcccgtctccgccggtgacatcttccgcgcctgccagaccaag
gacgctccgatcaaggactgggtgaagctggccgtcacccgggcccgcgccaccggcgat
ccggcggtgttctggctggacgccacccgcgcccacgacgccaacctgatcaagaaggtc
gagcagtacctgccggagcacgacaccgagggcctggagatcaagatcctgtccccggtg
gaggcgaccaagctgtcggtggagcgcatccgccgcggcgagaacaccatctcggtcacc
ggcaacgtcctgcgcgactacctgaccgacctgttcccgatcctggagctgggcaccagc
gccaagatgctgtcggtggtcccgctgatggcgggcggcggcctgttcgagacgggcgct
ggcggctccgcgcccaagcacgtccagcagctcgtcaaggagaactacctgcgctgggac
tccctcggcgagttcttcgcgctggtgccgtcgctggagcagtacgccgaggccacgggc
aacgcccgcgccaaggtcctcgccgacaccctcgaccgtgccacggcgaccttcctcaac
gaggacaagtccccgacccggcgggtcggcggcatcgacaaccgcggcagccacttctac
ctgtccctgtactgggcgcaggagctggcgcggcagaccgacgacgccgacctggccaag
gcgttcgcgccgctggccgagaccctcgccgccaacgagcagaagatcgtcgacgagctg
aacgccgtccagggcaagccggtcgacatcggcggctactaccagcccgacccggccaag
gccgccgaggtcatgcgcccgtcggccacctggaacgaggcgctggcgtccctgagctga

DBGET integrated database retrieval system