KEGG   Streptomyces leeuwenhoekii: sle_11180Help
Entry
sle_11180         CDS       T04414                                 

Gene name
sle_11180
Definition
(GenBank) DNA ligase
Organism
sle  Streptomyces leeuwenhoekii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: CQR60580
UniProt: A0A0F7VMJ9
LinkDB All DBs
Position
chromosome:1390556..1391662
Genome map
AA seq 368 aa AA seqDB search
MQAHNRTMDLPVMPPVKPMLAKSVAKIPPGMQYEAKWDGFRAIVFRDGPEVEFGSRTTKP
LTRYFPELVTAVQERLPERCVLDGEIVIAREGRLDFDALTERIHPADSRVRMLAERTPAS
FVAFDLLALDGESLLDLALADRRALLVRALAEVAAPVHVAPATTDAEVARHWFEQYEGAG
LDGVVAKPLNLRYLQDERAMFKVKHERTADVVVAGYRFHKSGPVVGSLLLGLYDERGALQ
HVGVSAAFSMRRRAELVEELEPLRLDDVSGHPWAAWADEAAHETARLPGAPSRWSGKKDL
SWVPLRPERVAEVAYDHMENGARFRHTARFRRWRPDRTPESCTYAQLEEPVRYDLAEIFA
PPATSSRG
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcgcacaatcggaccatggatctgccggtcatgccgcccgtgaagccgatgctc
gccaagtccgtggcgaagatcccgccgggcatgcagtacgaggcgaagtgggacggcttc
cgggcgatcgtcttccgcgacggcccggaggtcgaattcggcagccgcaccaccaagccg
ctgaccaggtactttcccgagctggtgacggccgtgcaggagcggttgcccgagcggtgc
gtgctggacggagagatcgtgatcgcgcgggagggccggctggacttcgacgcgctgacc
gagcgcatccatccggccgactcccgggtgcggatgctggcggagcggacgccggcctcc
ttcgtcgccttcgacctgctggcgctggacggcgagtccctgctcgacttggcgctcgcc
gaccggcgggcgctgctggtccgggcgctcgccgaggtcgccgccccggtgcacgtggcg
cccgcgacgaccgatgccgaggtggcgcggcactggttcgagcagtacgagggcgccggg
ctggacggtgtcgtcgccaagccgctgaacctgcgctacctccaggacgagcgggccatg
ttcaaggtcaagcacgagcggacggcggacgtggtggtggccggctaccggttccacaag
agcgggcccgtcgtcggttcgctgctgctcggcctgtacgacgagcgcggcgccctccag
cacgtgggcgtgtccgccgccttctccatgaggcggcgggccgagctggtggaggagctg
gagccgctgcgcctggacgacgtctcggggcacccctgggcggcgtgggcggacgaggcg
gcgcacgagacggcgcggctgccgggcgcaccgagccgctggtccggcaagaaggatctg
tcctgggtgccgctgcggccggagcgggtcgccgaggtggcctacgaccacatggagaac
ggggcgcgcttccggcacacggcccgcttccgccgctggcgccccgaccgcacgccggag
agctgcacctacgcccaactggaggagccggtgcgctacgacctcgcggagatcttcgcg
ccgccggcgacgtcgtcgcggggctga

DBGET integrated database retrieval system