KEGG   Streptomyces leeuwenhoekii: sle_12050Help
Entry
sle_12050         CDS       T04414                                 

Gene name
sle_12050
Definition
(GenBank) Sialidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
sle  Streptomyces leeuwenhoekii
Pathway
sle00511  Other glycan degradation
sle00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sle00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    sle_12050 (sle_12050)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    sle_12050 (sle_12050)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:sle02042]
    sle_12050 (sle_12050)
Enzymes [BR:sle01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     sle_12050 (sle_12050)
Bacterial toxins [BR:sle02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   sle_12050 (sle_12050)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 Laminin_G_3 BNR BNR_3 Laminin_G_2 DUF4185 Laminin_G_1
Motif
Other DBs
NCBI-ProteinID: CQR60667
UniProt: A0A0F7VT34
LinkDB All DBs
Position
chromosome:1495272..1497113
Genome map
AA seq 613 aa AA seqDB search
MTALLALAATAASPAQSGTGPPGRAPLFEEQVLFQAGREPGYACFRIPAIVRTTSGTLLA
FAEGRVLNCGDAADIDIVLRRSTDGGRTWGPLSVVNDGGGDTHGNPVPLVDRETGRVLLA
ETYNTGRTDAAGCGVPCDRRPHLQYSDDDGLTWSAPRDLSGDIRPAHWNSWYATGPVHGV
QLARGAHSGRLVFGVNAETWDGGRVTANHAALAVSDDGGANWRIGAIDTWPVPAGGPFRQ
KPSELTLAELADGSLLVSGREQDGTDLGHRTQTVSRDGGDTFAAPFRAIPDFATPQVQGA
LLRLGDRLLLSAPADPDRRRTMVVRSSYDGGATWESVDRATVVTRDWSGYSDLVALDDEG
TVGLLYEGGKADARDEIRFARFTEEWLAPRRGPDPVTPDLAPGAPPAAVLGGAAVTDGAI
GGALAFDGTDDAVRLPYRAALPLGTKDFTASLWFRYTAARGEQPLLWMGGVGTTQPQVWL
RAEPAHDRVQGLITARDGVSAPRSTYVRAAGARNDGRWHHLVLRRGQGRLTLFADGARLG
TVADVPGSVSRDSPFGVHLGRRMDGRASFTGAIDEVRVWDRALTDGEVAGLRTAGAPQGT
VLSLPLDTVRPGG
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgctgctcgcgctcgccgcgacggccgcctcccccgcgcagtccggcaccgga
ccgcccggccgcgcaccgctgttcgaggaacaggtcctcttccaggcgggccgggagccc
ggttacgcctgtttccgcatcccggcgatcgtgcggacgacctccggaacgctcctcgcc
ttcgccgagggccgggtcctcaactgcggggacgcggccgacatcgacatcgtcctcaga
cgctccaccgacggcggccggacctggggcccgctgtcggtcgtcaacgacggcggcggc
gacacgcacggcaacccggtgccgctcgtggaccgggagaccggccgcgtcctgctcgcc
gagacctacaacaccgggcggacggacgcggccggctgcggagtgccctgcgaccgccgg
ccccatctccagtacagcgacgacgacggtctcacctggtcggcgccgcgcgacctgagc
ggcgacatccgccccgcccactggaactcctggtacgccaccgggcccgtgcacggcgtc
cagctcgcccgcggcgcgcactccgggcgtctggtgttcggtgtcaacgccgagacctgg
gacggcggccgggtcaccgccaaccacgcggcgctggcggtcagcgacgacggcggggcg
aactggcggatcggcgccatcgacacctggccggtccccgccggcgggcccttccggcag
aagccgtccgagctgaccctcgccgagctggccgacggctccctcctggtcagcggccgg
gaacaggacggcaccgacctcggccaccgcacccagaccgtcagccgggacggcggcgac
accttcgccgcgcccttccgggccatcccggacttcgccacgccccaggtgcagggcgcc
ctgctccgcctgggcgaccgcctgctgctgtccgccccggccgaccccgaccgccgccgc
acgatggtggtccgctcctcctacgacggcggcgccacctgggagagcgtggaccgcgcc
acggtcgtcacccgggactggtccggctactccgacctggtggccctcgacgacgagggc
accgtgggactgttgtacgagggcgggaaggccgacgcgcgcgacgagatccgcttcgcc
cgcttcaccgaggagtggctggccccgcgccgcggccccgacccggtcacaccggacctc
gcgccgggcgccccgcccgccgcggtcctcggcggcgccgcggtgacggacggcgcgatc
ggcggcgcgctcgccttcgacggcaccgacgacgccgtacggctgccgtaccgcgcggcg
ctgcccctgggcaccaaggacttcacggcgtcgctgtggttccggtacacggcggcccgg
ggggagcagccactgctgtggatgggcggggtgggcaccacccagccccaggtgtggctg
cgggccgagcccgcgcacgaccgcgtccagggcctgatcaccgcgcgcgacggcgtgtcc
gccccacggtcgacgtacgtgcgggccgcgggcgcccgcaatgacggccgctggcaccat
ctggtgctgcgccgcggccaggggcggctgaccctgttcgccgacggcgcgcggctcggc
acggtggcggacgtacccggctcggtcagccgcgactcgccgttcggcgtgcatctgggc
cggcgcatggacggccgggcctccttcaccggggcgatcgacgaggtacgggtctgggac
cgggcactgaccgacggggaggtcgccgggctgcgcacggccggggccccgcagggcacc
gtcctgtcgctgccgctggacacggtgcgtcccggcggctga

DBGET integrated database retrieval system