KEGG   Streptomyces leeuwenhoekii: sle_16630Help
Entry
sle_16630         CDS       T04414                                 

Gene name
sle_16630
Definition
(GenBank) Hypothetical Protein sle_16630
Organism
sle  Streptomyces leeuwenhoekii
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CQR61125
UniProt: A0A0F7VNG5
LinkDB All DBs
Position
chromosome:complement(2052146..2055457)
Genome map
AA seq 1103 aa AA seqDB search
MAWRDRLRRRAAGADGPSGSGAGGRDGGAPDARGSALPGPASPSGPDSSGSDASGASTAA
PGAAAPASSVPGDWDGGWRRTAAPELTLSRAPLGVSDGLSFRAGLTAWQNPSFGTGLGHA
VLPTAPAGVVRGVVGPATPRTIGTGGGPLLLGAPRGHGAGEPRPAAETGQAADGGDRQNP
PPATPRGARQEGRASGSSGPAPRSRPSSRPAPSDPAGSPGSSDPAGTSGPAGAPTGGPGG
APRSRGLLSAGSAGTLPSAPPAVQRAERPGGGPSPIADIPLVRRVAAVTPGPGRDEPVVQ
RAARRASGGPYAPQPQTQTQPQAQERTRPQARPQTQAAPRTRSTGSGAEPKHTPRTPSGS
GGTPPGRAARSGGPERAGASRTSDAPASRGSDVSRPSRASGTSDASAASEEASAAGAGAG
AGAGAGAGAGAGAGVGVGVEAGASFPAARVRPVGGALTVARRPAGPVRRVRAVPPAVLPA
PGDRADGGTAAPSPAGAVAPATGPAQRTARSAEDRAPLGAPLNALPATALPATDLPTADG
STRPSAPAARSAAGAPAASGPALPVVQRHAQDGAGTPGPHDVGEGRTAHGGPAARAGATD
PASGTGRGGARARGGLGAPLSALPPSAELPRSAASGRPAPPTGYGPDVQRAPARPDGGAD
TASAASRTDGGRTAAPRTAPGAAPPPSSAGSPPGGAEHSPLLGTREVQRLAGPAAEGAAR
PGSADPGQDSARPLVKPSSDGAARPASREATGAVAAAADPRGARPATVRGPGGQPPREPV
VPVRPVSAARPVHGGASGAGVRTGAGAAPSPDAAGRGALTVSRAPVLPVPAAPRTLPLLA
ARPLRTETRLPEGAAPPVASRPGGRPVVAARWTGAPAGVSAAPRSGTTPHPGPAPGAATP
SAPPGVRSAAVRPGPAAAGTGRAASAGSGRGVPVVRPAPHRGGTPGTTVQPAAAPARSLP
VAGARTPAPTGPAAAAVPPAPPASVPVVRPRAVPAGPGPATGGEKGPVAPVVQRKAAGTA
QAAGGAPPAGPRSASPPSASGTPVSRTSASGTAHRAGAPPDPGPDRDDLDDLARRLLDPV
SRLLRAELRRGRERMGRPHDRRR
NT seq 3312 nt NT seq  +upstreamnt  +downstreamnt
atggcatggcgggacaggctgcgccgccgggccgccggagcggacggtccgtccggctcc
ggggccggaggccgggacgggggagcccctgacgcccggggctccgccctgcccggtccc
gcgtcgccgtccgggccggattcctccgggtccgacgcctccggggcgagtaccgcggca
cccggtgccgcggcgcctgcttcctcggttcccggcgactgggacggcggatggcggcgc
accgcggcgccggaactcaccctgtcgcgcgcgccgttgggagtcagcgacggtctgtcc
ttccgggccggcctgaccgcttggcagaacccctccttcggcaccggcctggggcatgcc
gtgctgcccacggccccggcgggcgtggtgcggggcgtcgtcggtccggccaccccccgc
accatcggcacgggcggaggcccgctgctgctcggcgcgccgcgcgggcacggcgcgggg
gaaccacggcccgccgccgagaccgggcaggccgcggacggcggggaccggcagaacccg
ccgcccgcgaccccgcgcggggcgcgtcaggaagggcgggcgtccggctcgtccggcccg
gcgccccggtcccgtccgtcctcccggcccgctccctccgacccggccggttcgcccggt
tcatccgacccggccggtacgtccggtccggccggtgcgcccaccggcggcccgggcggc
gcgccgcggtcccggggcctgctgtccgccggctccgccggaacgctgccctcggcgccc
cccgccgtccagcgggcggagcggcctggcggcggaccgagcccgatcgccgacattccg
ctggtccggcgggtggcggcggtcacccccggcccgggccgggacgagccggtggtccag
cgtgccgcccggcgtgcctccggcgggccgtacgccccacagccacagacacagacacag
ccacaggcccaggaacggacacggccacaggcacggccgcagacacaggccgcgccgcgc
acgcgttccaccgggtccggggcggagccgaagcacaccccccggacgccgtccggctcc
ggaggcacaccgcccggccgggccgcccggagcggcgggccggagcgggcgggcgcgtcc
cggacctctgacgcccccgcctcccggggctccgatgtctcccgcccctctcgcgcctct
ggtacctctgacgcctcggctgcttccgaggaagcatccgccgccggagccggagccgga
gccggagccggagccggagccggggccggggccggggccggggtcggggtcggggtcgag
gccggggcctccttcccggccgcccgtgtccgcccggtggggggcgcgctgaccgtcgcc
cggcgccccgccggacccgtgcgccgggtccgcgctgtgccgcccgccgtactcccggcg
cccggtgaccgcgccgacggcggcaccgccgcaccgtcacccgccggagccgtcgcaccg
gccaccggtccggcgcagcgcaccgcccggagcgcggaagaccgcgcgcccctcggcgcg
ccactgaacgccctgcccgccacagccctgcccgccacggacctgcccacggcggacggc
tccacccgcccgtccgcccccgccgcccggtcggcggccggcgcccccgccgcgtccggc
ccggcgctgcccgtcgtccagcgccacgcccaggacggtgcggggacgccgggaccgcac
gacgtgggggaggggcggacggcccacggcggtccggcggcgcgggccggtgccacagac
ccggcgtccggcaccggccgcggcggggcccgtgcccgcggcggcctcggcgcgccgctg
tccgcgctgccgcccagcgccgaactgccgcgttccgccgcgtcgggccgtcccgctccg
cctaccgggtacggcccggacgtccagcgtgccccggcgcgcccggacggcggcgcggac
accgcgtcggcggcgtcccgtacggacggcggccggacggcggcgccgcgtaccgccccc
ggtgcggccccgccgccgtcgtcggcgggttcgccgccgggaggcgcggagcactccccg
ctgctggggacgcgggaggtccagcgcctcgcgggccctgccgccgagggcgccgcccga
cccggttccgccgaccccggccaggattccgccaggccgctggtgaagccctcgtcggac
ggcgcggcccgccccgcgtcccgcgaggccaccggcgccgtcgcggcggcggccgacccc
cgcggtgcccgcccggccaccgtgcgcgggccgggcgggcaaccgccccgggaacccgtc
gtcccggtccgcccggtctccgcggcccggcccgtgcacggtggtgcgagcggtgccggc
gtacggaccggcgccggggccgccccgtccccggacgcggccggccggggcgcgctcacc
gtgagccgcgccccggtgctcccggtcccggcggcaccgcgcaccctgcccctgctcgcc
gcacgcccgctgcgtacggagacccggctcccggaaggtgcggctccgcccgtcgcctcc
cgccccggaggccgtcccgtggtggccgcgcgctggaccggcgcaccggcgggggtgagc
gccgccccccgaagcgggaccaccccgcacccgggcccggcgccgggcgcggccacaccg
tcggcgcccccgggcgtgcggtccgcggccgtgcgccccgggccggccgcagcgggcacc
ggccgggccgcgagcgccggttccggccggggcgtcccggtcgtgcgtcccgcaccgcac
cggggaggcacccccgggaccaccgtccagcccgccgccgcaccggcacggtcgcttccg
gtggccggggcccggacgcccgcgcccacgggcccggccgccgccgcggtgccaccggcc
ccgccggcttccgtcccggtggtccgtccgcgtgccgttcccgcggggcccggaccggcg
acgggcggcgagaagggcccggtcgcgcccgtggtgcagcgcaaggccgccggtaccgcg
caggccgccgggggagcgccgcccgccgggccgcgatccgcctccccgccgtccgcctcc
ggtacgccggtctcccgtacgtcggcctccggcaccgcgcaccgggcgggggcgccgccg
gacccgggtccggaccgggacgacctggacgacctggcgcgccgcctgctcgacccggtg
tcccggctgctgcgcgccgaactgcggcgcggccgggaacgcatgggccgcccccacgac
cgccgccgctga

DBGET integrated database retrieval system