KEGG   Streptomyces leeuwenhoekii: sle_19690Help
Entry
sle_19690         CDS       T04414                                 

Gene name
sle_19690
Definition
(GenBank) Oligopeptide transport ATP-binding protein OppD
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
sle  Streptomyces leeuwenhoekii
Pathway
sle02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sle00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    sle_19690 (sle_19690)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sle02000]
    sle_19690 (sle_19690)
Transporters [BR:sle02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    sle_19690 (sle_19690)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 SMC_N AAA_29 AAA_22 AAA_16 Mg_chelatase AAA_25 CbiA PRK AAA_5
Motif
Other DBs
NCBI-ProteinID: CQR61430
UniProt: A0A0F7VNX3
LinkDB All DBs
Position
chromosome:2422178..2423179
Genome map
AA seq 333 aa AA seqDB search
MSLLDVRDLTVTYAGGAAAVRGVGLRLEAGRKLGIAGESGCGKSTLALALLRLLPPGTRV
TGEILLDGEDVLTMKWGRVRAVRWAGASIVFQGAMHSLNAVHRVGDQIAEPILLHRKATP
AGARRKTGELLEQVGLPAARADAYPHELSGGQRQRVMIAMALACDPRLIVADEPTTALDV
MVQAQILRLIEQLVTEQDLGLIMISHDLAVLADTCDRLAVMYAGRVVEEGPARQVYEDAR
HPYAQALSAAFPRIGDPASRFAPRGLAGDPPDPAAVPPGCAFHPRCPVVLESCATQDQVL
RGAGAHRRAACVRVAGEPAPEPDDFEEARRATP
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctgctcgacgtcagggacctgacggtgacgtacgccggtggcgcggccgcggtc
cggggggtcggcctgcgcctggaggcgggccgcaagctcggcatcgccggggagtcgggc
tgcggcaagtccaccctggcgctggcgctgctgcggctgctgccgcccgggacccgtgtc
accggggagatcctgctcgacggcgaggacgtgctgacgatgaagtggggccgggtgcgg
gcggtccgctgggccggggcctccatcgtcttccagggcgcgatgcactccctcaacgcc
gtgcaccgcgtcggcgaccagatcgcggagccgatcctgctgcaccgcaaggccaccccg
gccggggcccgcaggaagaccggcgaactgctggagcaggtcggtctgcccgccgcccgc
gccgacgcctacccgcacgaactgtccggagggcagcgccagcgcgtcatgatcgcgatg
gcgctggcctgcgacccgcggctgatcgtcgccgacgagccgaccaccgcgctcgacgtg
atggtccaggcgcagatcctgcggctgatcgaacagctcgtcaccgagcaggacctgggc
ctgatcatgatcagccacgacctcgccgtcctcgccgacacctgcgaccggctcgccgtg
atgtacgcggggcgggtggtcgaggagggcccggcccggcaggtgtacgaggacgcccgg
catccgtacgcgcaggccctgtcggccgcgttcccccggatcggcgacccggcctcgcgg
ttcgcgccgcgcgggctggcgggcgatccgccggatccggcggccgtgccgcccgggtgc
gcgttccacccgcggtgcccggtggtgctggagtcgtgcgccacccaggaccaggtgctg
cgcggcgccggggcgcaccggcgggcggcgtgtgtgcgggtggccggggagccggccccg
gagccggacgacttcgaggaagcgaggcgcgccaccccatga

DBGET integrated database retrieval system